<?xml version="1.0" encoding="UTF-8"?>
<?xml-stylesheet type="text/xsl" media="screen" href="/~d/styles/rss2full.xsl"?><?xml-stylesheet type="text/css" media="screen" href="http://feeds.feedburner.com/~d/styles/itemcontent.css"?><rss xmlns:dc="http://purl.org/dc/elements/1.1/" version="2.0">
	<channel>
		<title>WikiPilipinas: The Hip 'n Free Philippine Encyclopedia - New pages [en]</title>
		<link>http://en.wikipilipinas.org/index.php?title=Special:Newpages</link>
		<description>From WikiPilipinas: The Hip 'n Free Philippine Encyclopedia</description>
		<language>en</language>
		<generator>MediaWiki 1.10.0</generator>
		<lastBuildDate>Fri, 25 May 2012 17:20:32 GMT</lastBuildDate>
		<atom10:link xmlns:atom10="http://www.w3.org/2005/Atom" rel="self" type="application/rss+xml" href="http://feeds.feedburner.com/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen" /><feedburner:info xmlns:feedburner="http://rssnamespace.org/feedburner/ext/1.0" uri="wikipilipinasthehipnfreephilippineencyclopedia-newpagesen" /><atom10:link xmlns:atom10="http://www.w3.org/2005/Atom" rel="hub" href="http://pubsubhubbub.appspot.com/" /><item>
			<title>MarysaUlrich842</title>
			<link>http://en.wikipilipinas.org/index.php?title=MarysaUlrich842</link>
			<description>&lt;p&gt;Summary: New page: Perks Of Using Residual Income Opportunities To Make Money Online  Are you aware that you can use residual income opportunities to assist you earn money on the internet? Many individuals h...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Perks Of Using Residual Income Opportunities To Make Money Online&lt;br /&gt;
&lt;br /&gt;
Are you aware that you can use residual income opportunities to assist you earn money on the internet? Many individuals have successfully done this and you can to, but first you should understand the many perks to earning money this way.&lt;br /&gt;
&lt;br /&gt;
Below are the perks that you should know so you can understand why numerous individuals pick this way to profit.&lt;br /&gt;
&lt;br /&gt;
One: Make as much money as you would like for as long as you want - With this sort of income opportunity, you are the one that chooses just how much money you may make and how long you will definitely make it.&lt;br /&gt;
&lt;br /&gt;
One advantage about this kind of income is that once you get a person to register the opportunity or to buy a product, you may profit from them every month for as long as they remain a member of that opportunity.&lt;br /&gt;
&lt;br /&gt;
With the internet being your marketing ground, you have an opportunity to make as much money as you would like to so you can quickly begin living life the way you prefer to.&lt;br /&gt;
&lt;br /&gt;
2: You have complete control over your business - By having a residual income business, you are the one that controls your very own business and the money you make. This is an enormous perk for lots of folks since they are not allowed to do this with a routine job.&lt;br /&gt;
&lt;br /&gt;
You do not need to fret about when you will certainly get a pay increase or when you may lose your job. Because you are in control, these are concerns you will never ever have once more.&lt;br /&gt;
&lt;br /&gt;
Three: Easy to find out and use to earn money - These opportunities are extremely uncomplicated for anybody to learn and use to earn money. There will certainly be an understanding curve that may suggest you need to discover precisely how to develop your own successful business, however over time it is not really challenging to do.&lt;br /&gt;
&lt;br /&gt;
Making use of the right tools and studying precisely how to do different things to construct a business are very essential. You can easily study what these methods are by doing your study and by observing the training and tools that the opportunity provides for you.&lt;br /&gt;
&lt;br /&gt;
Now that you understand these crucial benefits of using [http://www.website.ws/freedombucks residual income] opportunities to profit online, you just need to identify the best opportunity for you to get your own business began immediately. Don't delay due to the fact that the earlier you starting, the faster you may have the ability to attain the success you have constantly dreamed of.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/gGnOiF9FQk2NjYnltkV6HIG0lkE/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gGnOiF9FQk2NjYnltkV6HIG0lkE/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/gGnOiF9FQk2NjYnltkV6HIG0lkE/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gGnOiF9FQk2NjYnltkV6HIG0lkE/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/cM3GumMd74A" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 16:02:16 GMT</pubDate>			<dc:creator>MarysaUlrich842</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:MarysaUlrich842</comments>		</item>
		<item>
			<title>Futurafuturace150824</title>
			<link>http://en.wikipilipinas.org/index.php?title=Futurafuturace150824</link>
			<description>&lt;p&gt;Summary: New page: Purchasing A new Sewing Machine - Giving You The Power  Congratulations on deciding to purchase a brand new sewing machine, it's a selection that need to provide you with quite a few hours...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Purchasing A new Sewing Machine - Giving You The Power&lt;br /&gt;
&lt;br /&gt;
Congratulations on deciding to purchase a brand new sewing machine, it's a selection that need to provide you with quite a few hours of sewing pleasure and must be a choice that you are comfy and pleased that you just have created. Regrettably really frequently the shopping encounter just isn't one particular that people today have enjoyed, they at times really feel that they've been pressured by sales people today in to producing choices ahead of they may be able to do so, they really feel they've been persuaded into spending over they planned to, they wind up using a sewing machine that is definitely not appropriate for their specifications. If any of this sounds familiar then please read on as we aim to assist you with some simple to adhere to suggestions that may place you back in charge in the acquiring method.&lt;br /&gt;
&lt;br /&gt;
Understanding what you desire, should you usually do not will need a sewing machine which has 50 unique capabilities then don't invest in one particular with all of the bells and whistles. Fairly normally any time you go in to a shop the sales individual might be keen to sell you a specific machine, this could possibly be one of the most highly-priced a single they've or just the a single with all the finest commission for the retailer, in case you usually do not want that model or brand tell them. Ahead of you visit the shop I'd generate a list with the functions I need to have my sewing machine to possess, armed with this list I'm in a position to tell the sales individual what I want and I can examine what he is showing me with my list of needs and if they usually do not match then tell him he is just not showing you what you'd like to purchase.&lt;br /&gt;
&lt;br /&gt;
Figuring out what you usually do not want, this may well sound slightly unusual, but when you are not pleased with some thing on your present sewing machine, if the identical point keeps going incorrect by way of example or if a single component breaks extra typically than you really feel it ought to, then tell the sales individual this, you of course usually do not would like to have the identical challenges along with your new machine that you just had along with your old 1.&lt;br /&gt;
&lt;br /&gt;
Test drive the sewing machine, any time you have discovered a sewing machine that you're enthusiastic about ask the sales rep to get a demonstration, please ask queries should you don't fully grasp a thing they do or say as generally the sales reps possess a set demo and patter to go with it and this could appear quite a bit sleeker than it actually is. It's essential to also ask to test the sewing machine for oneself, take a swatch of the personal fabric with you as an old trick amongst sales reps is usually to use stiff material which is a lot less complicated for some elements of sewing and can thus provide you with a false sense of self-confidence. Making use of your personal swatches also implies that you'll be able to carry it from machine to machine too as shop to shop and get a correct comparison amongst the distinctive sewing machines on supply.&lt;br /&gt;
 [http://singerfuturace250reviews.com Singer Futura CE-250]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/lM7lVRcGSGTK7ZpLJg1TJO4myAo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/lM7lVRcGSGTK7ZpLJg1TJO4myAo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/lM7lVRcGSGTK7ZpLJg1TJO4myAo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/lM7lVRcGSGTK7ZpLJg1TJO4myAo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/uZTccpq5O7I" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 13:36:01 GMT</pubDate>			<dc:creator>Futurafuturace150824</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Futurafuturace150824</comments>		</item>
		<item>
			<title>Benedictine International School of Quezon City</title>
			<link>http://en.wikipilipinas.org/index.php?title=Benedictine_International_School_of_Quezon_City</link>
			<description>&lt;p&gt;Summary: New page: if there need a teacher.&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;if there need a teacher.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/4pIN9knaYnagpoFdN5NsHHANpRQ/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4pIN9knaYnagpoFdN5NsHHANpRQ/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/4pIN9knaYnagpoFdN5NsHHANpRQ/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4pIN9knaYnagpoFdN5NsHHANpRQ/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/1yTRgE4uKzo" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 12:57:00 GMT</pubDate>			<dc:creator>Nekoningyo</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Benedictine_International_School_of_Quezon_City</comments>		</item>
		<item>
			<title>Batasan Chuman Christian School, Inc.</title>
			<link>http://en.wikipilipinas.org/index.php?title=Batasan_Chuman_Christian_School%2C_Inc.</link>
			<description>&lt;p&gt;Summary: New page: if there hired teacher&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;if there hired teacher&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/HMjKjh7pdBkoE-5xXkQC7WXa1-4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HMjKjh7pdBkoE-5xXkQC7WXa1-4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/HMjKjh7pdBkoE-5xXkQC7WXa1-4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HMjKjh7pdBkoE-5xXkQC7WXa1-4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/Xra-k_8z-kc" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 12:53:31 GMT</pubDate>			<dc:creator>Nekoningyo</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Batasan_Chuman_Christian_School%2C_Inc.</comments>		</item>
		<item>
			<title>GaddyEmbree637</title>
			<link>http://en.wikipilipinas.org/index.php?title=GaddyEmbree637</link>
			<description>&lt;p&gt;Summary: New page: [http://www.kudubids.com Kudu Bids] penny auction website may be newer but because of their simplicity, the site offers a fresh experience in an online shopping experience. This is what ma...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[http://www.kudubids.com Kudu Bids] penny auction website may be newer but because of their simplicity, the site offers a fresh experience in an online shopping experience. This is what makes [http://www.kudubids.com Kudu Bids] penny auction website stands out from the rest and become the top rated penny auction website online. You not only get the best deals at very low prices, but you also receive excellent customer support. &lt;br /&gt;
[http://www.kudubids.com Kudu Bids] penny auction website introduces a fresh, unique style of online auctions and excellent management team which is making it grow in popularity each day.&lt;br /&gt;
Each day at [http://www.kudubids.com Kudu Bids] penny auction, there is a great selection of products available to bid on. One of the reason that makes this site better than others is that there are scheduled times for the suctions so that you know exactly when to participate. This ensures that you never miss out on a chance to participate in any of the auctions  penny auction website has to offer.  The best part of Kudu Bids penny auction website is that the auctions offered can be won for prices well below retail value each day!&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/0Vf13PTPHzjgHp4hSlWfhU06X_0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/0Vf13PTPHzjgHp4hSlWfhU06X_0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/0Vf13PTPHzjgHp4hSlWfhU06X_0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/0Vf13PTPHzjgHp4hSlWfhU06X_0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/4Y8O30qmq-U" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 12:00:55 GMT</pubDate>			<dc:creator>GaddyEmbree637</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:GaddyEmbree637</comments>		</item>
		<item>
			<title>CoralieDigiacomo296</title>
			<link>http://en.wikipilipinas.org/index.php?title=CoralieDigiacomo296</link>
			<description>&lt;p&gt;Summary: New page: This is all about me, baby. All about me.&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This is all about me, baby. All about me.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/HDprf2qaeza86wQaJmaNd_BkdSs/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HDprf2qaeza86wQaJmaNd_BkdSs/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/HDprf2qaeza86wQaJmaNd_BkdSs/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HDprf2qaeza86wQaJmaNd_BkdSs/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/bbG7RuRh_Yo" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 11:48:06 GMT</pubDate>			<dc:creator>CoralieDigiacomo296</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:CoralieDigiacomo296</comments>		</item>
		<item>
			<title>ClaudineAtchley23</title>
			<link>http://en.wikipilipinas.org/index.php?title=ClaudineAtchley23</link>
			<description>&lt;p&gt;Summary: New page: Brother Embroidery Appliance : Sewing Manufactured Quick  Inside 1954, the actual Pal embelleshment equipment had been primary taken to the usa by Okazaki, japan. These equipment built lif...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Brother Embroidery Appliance : Sewing Manufactured Quick&lt;br /&gt;
&lt;br /&gt;
Inside 1954, the actual Pal embelleshment equipment had been primary taken to the usa by Okazaki, japan. These equipment built lifestyle much easier for most larger ladies as well as seamstresses from coast to coast.&lt;br /&gt;
&lt;br /&gt;
Currently, there are various different types with the Pal embroidery products to match pretty much any type of stitches you want to do. Here i will discuss the favourite types today:&lt;br /&gt;
&lt;br /&gt;
1. PE700&lt;br /&gt;
&lt;br /&gt;
This particular Sibling embroidery device executes from a great 650 appears one minute. This particular equipment can be so quickly you'll be able to complete your stitching assignments from 50 % some time, departing people with increased time for you to devote to some other tasks.&lt;br /&gt;
&lt;br /&gt;
This specific Brother embroidery equipment is made for the particular busy contemporary girl exactly who basically doesn't have any time to help sit down all day which has a needle in addition to thread. While using the [http://www.cristiangriggio.com/brother-pe700-embroidery-machine.htm brother pe700 embroidery machine sale], you are able to enhance your current pillowcases or tablecloths whilst still being include time for you to make meals or see a health and fitness center.&lt;br /&gt;
&lt;br /&gt;
only two. PR600II&lt;br /&gt;
&lt;br /&gt;
Any time presently there a lot of colors interested in your job, your PR600II could be the best Buddy embroidery machine available for you. It offers 6 needles that may sew using 6 different posts almost all simultaneously. This may surely produce your job swifter, and you perform ought to train a lttle bit to get the particular suspend from it before entering an important venture.&lt;br /&gt;
&lt;br /&gt;
3. SE270D&lt;br /&gt;
&lt;br /&gt;
Having nearly a great number of stitch features bundled, this Buddy embroidery appliance is usually a giant. You can create fantastic embroidery using this machine specifically since it offers several pre-programmed designs you could choose from.&lt;br /&gt;
&lt;br /&gt;
This SE270D likewise uses your cassette method regarding place safe-keeping as well as attachment in to the needle. You will no longer have to get cross-eyed looking to fit the actual carefully thread with the attention of the hook since it is already performed automatically to suit your needs.&lt;br /&gt;
&lt;br /&gt;
several. IN2500D&lt;br /&gt;
&lt;br /&gt;
This particular Buddy embelleshment unit is usually a really high-tech gadget that's not any likeness at all towards regular curtains equipment your grandmother used in the woman morning. The actual IN2500D is a totally digital camera equipment, with a 10&amp;quot; by 6&amp;quot; LCD touch screen and a HARDWARE web site simply by which you'll place it to your personal computer in order to down load far more patterns in addition to designs.&lt;br /&gt;
&lt;br /&gt;
You can almost entirely customise your current embroidery venture on this appliance before you decide to start. It's functions that look after lay-outing, incrementing, running, in addition to much more now.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/9F0vbNA6G_nKo-5PpiKMuonQevY/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9F0vbNA6G_nKo-5PpiKMuonQevY/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/9F0vbNA6G_nKo-5PpiKMuonQevY/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9F0vbNA6G_nKo-5PpiKMuonQevY/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/YWY_bqT8hCk" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 11:36:26 GMT</pubDate>			<dc:creator>ClaudineAtchley23</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ClaudineAtchley23</comments>		</item>
		<item>
			<title>EmlynnYang324</title>
			<link>http://en.wikipilipinas.org/index.php?title=EmlynnYang324</link>
			<description>&lt;p&gt;Summary: New page: So you can purchase the latest Gucci handbags   If you get to know about the Gucci handbags then it's not at all surprising, the popularity of replica Gucci handbags has encouraged many co...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;So you can purchase the latest Gucci handbags&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
If you get to know about the Gucci handbags then it's not at all surprising, the popularity of replica Gucci handbags has encouraged many copycats who try to imitate the original Gucci handbags. Gucci handbags have become extremely popular over the years. Those women who want the look and feel of a designer Gucci handbag, but they do not want to pay thousands of dollars for one, have found a real treasure in replica designer handbags. The materials used by the products should be long-lasting and rugged.[ http://www.newstyleguccibags.com/gucci-top-handles-c-29 Gucci Top Handles ]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The inside layer of the genuine Gucci bags as well as the high quality of replica Gucci handbag should be tailored neatly. Replicas Gucci handbags are not necessarily, made up of poor quality material. The Gucci handbags can also sport a high quality material and the similar detailing of the craftsmanship. Whenever you go shopping online, you will be attracted by [ http://www.newstyleguccibags.com/gucci-hobo-bags-c-30 Gucci  Hobo Bags ].&lt;br /&gt;
&lt;br /&gt;
If you look at the price of these Gucci handbags, you will be hesitant because the price is very high and not in your budget. Now, you have another choice which is to login to bagsonlineshop. com to choose your favorite Gucci bags. If you find your favorite handbags, don't hesitate. Their products are always updating. So you can purchase the latest Gucci handbags.&lt;br /&gt;
$jdisweeu89p$&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/pWMRZSDXqMS8mZZe6Z7KE9-RbcA/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/pWMRZSDXqMS8mZZe6Z7KE9-RbcA/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/pWMRZSDXqMS8mZZe6Z7KE9-RbcA/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/pWMRZSDXqMS8mZZe6Z7KE9-RbcA/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/7wzl5iDTLn0" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 11:13:44 GMT</pubDate>			<dc:creator>EmlynnYang324</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:EmlynnYang324</comments>		</item>
		<item>
			<title>LarochelleLoyd283</title>
			<link>http://en.wikipilipinas.org/index.php?title=LarochelleLoyd283</link>
			<description>&lt;p&gt;Summary: New page: [http://www.kudubids.com Kudu Bids] penny auction website may be newer but because of their simplicity, the site offers a fresh experience in an online shopping experience. This is what ma...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[http://www.kudubids.com Kudu Bids] penny auction website may be newer but because of their simplicity, the site offers a fresh experience in an online shopping experience. This is what makes [http://www.kudubids.com Kudu Bids] penny auction website stands out from the rest and become the top rated penny auction website online. You not only get the best deals at very low prices, but you also receive excellent customer support. &lt;br /&gt;
[http://www.kudubids.com Kudu Bids] penny auction website introduces a fresh, unique style of online auctions and excellent management team which is making it grow in popularity each day.&lt;br /&gt;
Each day at [http://www.kudubids.com Kudu Bids] penny auction, there is a great selection of products available to bid on. One of the reason that makes this site better than others is that there are scheduled times for the suctions so that you know exactly when to participate. This ensures that you never miss out on a chance to participate in any of the auctions  penny auction website has to offer.  The best part of Kudu Bids penny auction website is that the auctions offered can be won for prices well below retail value each day!&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/XFosPlk_ylSzjn3aq6849gt8fMw/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/XFosPlk_ylSzjn3aq6849gt8fMw/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/XFosPlk_ylSzjn3aq6849gt8fMw/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/XFosPlk_ylSzjn3aq6849gt8fMw/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/sXzBNRy6YUQ" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 10:49:52 GMT</pubDate>			<dc:creator>LarochelleLoyd283</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:LarochelleLoyd283</comments>		</item>
		<item>
			<title>Animal Welfare Act of 1998</title>
			<link>http://en.wikipilipinas.org/index.php?title=Animal_Welfare_Act_of_1998</link>
			<description>&lt;p&gt;Summary: New page: The '''Republic Act 8485''', otherwise known as the '''Animal Welfare Act of 1998''', is an act to promote animal welfare in the [[Philippines]]. It was passed during former President [[Fi...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''Republic Act 8485''', otherwise known as the '''Animal Welfare Act of 1998''', is an act to promote animal welfare in the [[Philippines]]. It was passed during former President [[Fidel V. Ramos|Fidel V. Ramos']] term.&lt;br /&gt;
&lt;br /&gt;
==Purpose of the law==&lt;br /&gt;
Section 1 states that the act aims to protect and promote the welfare of all animals in the [[Philippines]] by supervising and regulating the establishment and operations of all facilities of all animals.&lt;br /&gt;
&lt;br /&gt;
Section 2 states that nobody shall establish, maintain and operate any animal facility (pet shop, kennel, veterinary clinic, veterinary hospital, stockyard, corral, stud farm or stock farm or zoo) without first securing from the [[Bureau of Animal Industry]] a certificate of registration. A certificate may be issued if facilities of such establishments are adequate, clean, and sanitary and will not be used to cause pain or suffering to the animals.&lt;br /&gt;
&lt;br /&gt;
Section 3 states that the Director of the [[Bureau of Animal Industry]] shall supervise and regulate the establishment and operation and maintenance of animal facilities and any other form or structure for the confinement of animals to provide maximum comfort while in transit and minimize incidence of sickness and death and prevent any cruelty from being inflicted upon animals.&lt;br /&gt;
&lt;br /&gt;
Section 4 states that it shall be the duty of any air, land, or water public utility which transports animals to provide adequate, clean, and sanitary facilities for the safe conveyance and delivery of animals. Sufficient food and water shall be provided to animals while in transit. No one shall transit any animal without a written permit from the Director of the [[Bureau of Animal Industry]]. Any form of cruelty shall be penalized. &lt;br /&gt;
&lt;br /&gt;
==Committee on Animal Welfare==&lt;br /&gt;
Section 5 states that a Committee on Animal Welfare attached to the [[Department of Agriculture]] is created to issue the necessary rules and regulations for the strict implementations of the provisions of the said Act. It includes the setting of safety and sanitary standards within thirty calendar days following its approval.&lt;br /&gt;
&lt;br /&gt;
The Committee is composed of the official representatives of the following:&lt;br /&gt;
*[[Department of Interior and Local Government]] (DILG) &lt;br /&gt;
*[[Department of Education]] (DepEd)&lt;br /&gt;
*[[Bureau of Animal Industry]] (BAI) of the [[Department of Agriculture]] (DA)&lt;br /&gt;
*[[Protected Areas and Wildlife Bureau]] (PAWB) of the [[Department of Environment and Natural Resources]] (DENR)&lt;br /&gt;
*National Meat Inspection Commission (NMIC) of the DA&lt;br /&gt;
*Agriculture Training Institute (ATI) of the DA&lt;br /&gt;
*Philippine Veterinary Medical Association (PVMA)&lt;br /&gt;
*Veterinary Practitioners Association of the Philippines (VPAP)&lt;br /&gt;
*Philippine Animal Hospital Association of the Philippines (PAHA)&lt;br /&gt;
*[[Philippine Animal Welfare Society]] (PAWS)&lt;br /&gt;
*Philippine Society for the Prevention of Cruelty to Animals (PSPCA)&lt;br /&gt;
*Philippine Society of Swine Practitioners (PSSP)&lt;br /&gt;
*Philippine College of Canine Practitioners (PCCP)&lt;br /&gt;
*Philippine Society of Animal Science (PSAS).&lt;br /&gt;
==Animal and its habitat's protection==&lt;br /&gt;
Section 6 states that it shall be unlawful to torture, neglect providing adequate care, sustenance or shelter or maltreat any animal. Killing of animals other than cattle pigs, goats, sheep, poultry, rabbits, carabaos, horses, deer and crocodiles is declared unlawful except during the following instances:&lt;br /&gt;
*When it is done as a part of religious rituals of an established religion or an ethnic custom of indigenous cultural groups&lt;br /&gt;
*When an animal is afflicted with an incurable and communicable disease as certified by a veterinarian&lt;br /&gt;
*When the killing is necessary to put an end to the misery suffered by an animal&lt;br /&gt;
*When it is done to prevent an imminent danger to the life of a human being&lt;br /&gt;
*When done to control animal population&lt;br /&gt;
*When an animal is killed after it has been used in an authorized research or experiment&lt;br /&gt;
&lt;br /&gt;
Section 7 states that every person shall protect the natural habitat of animals. Destruction of animal habitat is considered animal cruelty and its preservation is considered  a way of protecting animals.&lt;br /&gt;
&lt;br /&gt;
==Penalty for violations==&lt;br /&gt;
Section 8 states that a convicted person who violates any provision of this Act shall be punished by imprisonment of not less than six (6) months to not more than two (2) years or a fine of not less than one thousand pesos (P1,000.00) to not more than five thousand pesos (P5,000.00) or both at the discretion of the Court.&lt;br /&gt;
&lt;br /&gt;
==Criticisms==&lt;br /&gt;
According to an article about Animal Rights on About.com, one of the biggest criticisms of the Act is the exclusion of rats and mice, which make up the majority of animals used in research. Livestock are also excluded and there are no laws or regulations for the care of animals raised for food.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.chanrobles.com/republicactno8485.htm “Republic Act 8485”].''Chan Robles Virtual Law Library''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://onlovinganimals.blogspot.com/2012/02/philippines-animal-welfare-act-of-1998.html “Philippines. Animal Welfare Act of 1998. Amendments. HB 5849. Making a Good Thing Better.”].''On Loving Animals''.(Accessed on 25 May 2012)&lt;br /&gt;
*Lin, Doris.[http://animalrights.about.com/od/animallaw/a/AnimalWelfareAct.htm “Overview of the Animal Welfare Act”].''About.com: Animal Rights''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://www.tempo.com.ph/2011/nation-observes-animal-welfare-week/ “Nation observes Animal Welfare Week”].''Tempo''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://petiksatbp.wordpress.com/tag/animal-welfare-act-of-1998/ “Redefining “Animal Cruelty””].''Inside PETiks Doggie Day Care''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category:Philippine law]]&lt;br /&gt;
[[Category:Political and Public International Law]]&lt;br /&gt;
[[Category:Legal Codes]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/sdpxoqTzLTk" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 09:49:26 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Animal_Welfare_Act_of_1998</comments>		</item>
		<item>
			<title>Karl Roy</title>
			<link>http://en.wikipilipinas.org/index.php?title=Karl_Roy</link>
			<description>&lt;p&gt;Summary: New page: {{Infobox musical artist | name                      = Karl Roy | image                     =  | image_size                =  | alt                       =  | caption                   =  ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox musical artist&lt;br /&gt;
| name                      = Karl Roy&lt;br /&gt;
| image                     = &lt;br /&gt;
| image_size                = &lt;br /&gt;
| alt                       = &lt;br /&gt;
| caption                   = &lt;br /&gt;
| birth_name                = &lt;br /&gt;
| birth_date                = {{Birth date|1968|05|25}} &lt;br /&gt;
| birth_place               = [[Manila]], [[Philippines]] &lt;br /&gt;
| death_date                = {{Death date and age|2012|03|13|1968|05|25}} &lt;br /&gt;
| death_place               =  [[Quezon City]], [[Metro Manila]], Philippines&lt;br /&gt;
| death_cause               = [[Cardiac arrest]]&lt;br /&gt;
| native_name               = &lt;br /&gt;
| native_name_lang          =&lt;br /&gt;
| nationality               = Filipino&lt;br /&gt;
| alias                     = &lt;br /&gt;
| origin                    = &lt;br /&gt;
| background                = solo_singer&lt;br /&gt;
| instrument                = Vocals&lt;br /&gt;
| genre                     = Rock&lt;br /&gt;
| occupation                = Rock singer&lt;br /&gt;
| years_active              = &lt;br /&gt;
| label                     = &lt;br /&gt;
| associated_acts           = [[P.O.T.]]&amp;lt;br/&amp;gt;[[Kapatid (band)|Kapatid]]&amp;lt;br/&amp;gt;Advent Call&lt;br /&gt;
| spouse                    = Dena Roy &lt;br /&gt;
| children                  = Arianna Roy &lt;br /&gt;
| relatives                 = Kathryn Roy (sister) &amp;lt;br&amp;gt; Kevin Roy (brother) &amp;lt;br&amp;gt; Jose Roy III (cousin) &amp;lt;br&amp;gt; Jose Roy, Sr. (grandfather)&lt;br /&gt;
| website                   = &lt;br /&gt;
| footnotes                 = &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Karl Roy''' (25 May 1968- 13 March 2012) was a [[Filipino]] rock singer.  He was the vocalist of three [[Filipino|Pinoy]] rock bands: POT, ''Kapatid'', and Advent Call. One of his famous songs was ''Luha'' which he performed with ''Kapatid''.&lt;br /&gt;
&lt;br /&gt;
==Early life==&lt;br /&gt;
Roy was the grandson of former Senator Jose Roy. He was also the older brother of Kevin Roy, the lead singer of Razorback. His first cousin, Jose “Judd” Roy III, was one of the defense lawyers of the impeachment trial of [[Philippines|Philippines]] Chief Justice [[Renato Corona]].&lt;br /&gt;
&lt;br /&gt;
==Music career==&lt;br /&gt;
Roy started his career in the '80s as frontman for Advent Call. Roy and his bandmates held court at the old Mayric's in [[España, Manila]] and Red Rocks on Scout Tobias, [[Quezon City]]. These places were considered to be the breeding grounds of today's hottest groups. Roy quit Advent Call when record labels went on a signing spree in the 1990s to capitalize on the local band explosion.&lt;br /&gt;
&lt;br /&gt;
It was only until he joined the funk rock group POT that he became known to the public after having had a major hit: a cover of the Advisor's ''“Yugyugan Na”''. POT, however, did not last long. Its members blamed Roy's alleged unpredictable behavior for the band's demise.&lt;br /&gt;
&lt;br /&gt;
He continued making music by joining the band ''Kapatid'' with Nathan Azarcon and Ira Cruz of Hijo. POT reformed in October 2011. ''Kapatid'' released two albums: a self-titled album in 2003 and ''Luha'' in 2006.&lt;br /&gt;
&lt;br /&gt;
Although Roy never had another major hit after ''“Yugyugan Na”'', his cult-figure status and reputation as crowd favorite landed him on the covers of music and lifestyle magazines. He was even chosen as a [[San Miguel]] Red Horse Beer endorser in 2007.&lt;br /&gt;
&lt;br /&gt;
==Death==&lt;br /&gt;
Karl Roy died on 13 March 2012 at age 43 due to cardiac arrest. Prior to his death, he was brought to  Cardinal Rufino Santos Hospital in [[San Juan]], straight to the intensive care unit, for he complained of difficulty in breathing. He was said to have been diagnosed with Pulmonary Edema or fluid accumulation in the lungs. &lt;br /&gt;
&lt;br /&gt;
In September 2007, after shooting the TV commercial with [[Joey Smith|Joey “Pepe” Smith]] and other Red Horse talents, he suffered a stroke which left his body half paralyzed for months. When asked what he thinks allows him to continue surviving life, he said that he needed people to validate if what he's feeling was real.&lt;br /&gt;
&lt;br /&gt;
Hours after his death, he became a top trending twitter topic on Twitter Philippines for fans and celebrities expressed grief over his death.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*Casal, Marj.[http://www.gmanetwork.com/news/story/251239/lifestyle/people/pinoy-rock-legend-karl-roy-dies-at-43 “Pinoy rock legend Karl Roy dies at 43”].''GMA News Online''.(Accessed on 25 May 2012)&lt;br /&gt;
*Ramos, NR.[http://www.mb.com.ph/articles/354120/karl-roy-rock-legend-dies “Karl Roy, Rock Legend Dies”].''mb.com.ph''.(Accessed on 25 May 2012)&lt;br /&gt;
*Concepcion, Pocholo.[http://entertainment.inquirer.net/33415/rock-star-karl-roy-one-of-local-music%E2%80%99s-best-acts-43 “Rock star Karl Roy, one of local music’s best acts; 43”].''Inquirer Entertainment''.(Accessed on 25 May 2012)&lt;br /&gt;
*Cruz, RG.[http://www.abs-cbnnews.com/nation/03/13/12/judd-roy-karl-roy-we-marched-our-own-beat “Judd Roy on Karl Roy: We marched to our own beat”].''ABSCBNnews.com''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/entertainment/03/13/12/pinoy-rock-icon-karl-roy-dies “Pinoy rock icon Karl Roy dies”].''ABSCBNnews.com''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*Oliva, Erwin.[http://ph.omg.yahoo.com/news/pinoy-rock-icon-karl-roy-passes-away.html “Pinoy rock icon Karl Roy passes away”].''Yahoo! OMG!''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
{{DEFAULTSORT:Roy, Karl}}&lt;br /&gt;
[[Category:Filipino male singers]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/j_nVPFzX4h4" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 05:57:34 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Karl_Roy</comments>		</item>
		<item>
			<title>BetsyKelleher305</title>
			<link>http://en.wikipilipinas.org/index.php?title=BetsyKelleher305</link>
			<description>&lt;p&gt;Summary: New page: Make your profile invite helpful! Be part of Lions teams, TopLinked and Invitations Welcome likewise as teams that assist your pursuits. Give rise to people teams in talk allow persons und...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Make your profile invite helpful! Be part of Lions teams, TopLinked and Invitations Welcome likewise as teams that assist your pursuits. Give rise to people teams in talk allow persons understand what you might be about which you're taking networking severe. Place Lions and TopLinked with the top rated of the profile I like to recommend appropriate following your task title. Incorporate your electronic mail there also so if somebody needs to attach it really is simple to achieve this I also include things like the amount of 1st degree connections folks desire to hook up with huge networks. Now get noticed by inquiring &amp;amp; answering questions like you have done in this section. The last tip is situation yourself to show up in as many searches as possible consider your profile as real estate. Look at your working profession and list every work you have ever had including that work waiting tables in college. By listing every company you have been associated with you will definitely show up in more searches. If you look at my profile I list about 25 insurance companies that I was contracted with when I brokered insurance and investments. On a regular basis I contacts from people today wanting information on various companies etc. You can also go into the management portion of one's profile and change it so when you visit a profile it will show who you're not just you perform in XYZ industry. I have built a network of over 5100 direct and have only used 1200 of my invitations I’m not an expert but the these tips will assist.&lt;br /&gt;
Personally I have discovered a range of persons I lost contact with years ago. Just last week I was contacted by an individual who worked for me over 12 years ago. He identified me because an individual I was connected with (Who I never met) was connected to one of his personal contacts. Professionally I have several people today on LinkedIn who I use as sounding boards because they have knowledge that I don’t have. Over time as your network grows you are going to be surprised how important to your life and vocation LinkedIn might be.&lt;br /&gt;
&lt;br /&gt;
If you have any questions feel free to contact me directly rfiene@kforce.com. Oh and I except all invitations so feel free to send me an invite if you feel I can a value to your professional network. How to get [http://fiverr.com/ppscslv/get-you-7800-new-linkedin-real-people-contacts-from-linkedin-social-network 500+ LinkedIn Contacts], you really need to apply a little more time and focused energy than the average social networker does. I spent 1-2 hours per day growing my LinkedIn network when I first joined, and sought out connections that had relevance to my business (real estate, training and consulting). I asked for introductions from persons in my network that had prominent members in their own networks, and invited individuals I knew to become open networkers (LIONS, Toplinked.com members, etc.). In selecting these I wished to attach with, I tended to focus on all those with considerable networks themselves, because the association with significant networkers pays off for people in their connections network.&lt;br /&gt;
&lt;br /&gt;
I use my connections in a variety of ways: inquiring for introductions and introducing people looking for connections; striking up online, telephone and face-to-face conversations; sharing ideas and opportunities; and helping people today know the value and power social networking brings to their business.&lt;br /&gt;
&lt;br /&gt;
My connections have proven rather beneficial for me in building my knowledge base and skill seet, and have literally brought me business (consulting and speaking engagements). It has unquestionably been a wonderful experience, and I desire you luck as you develop your network.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/YcEPmB6RDnoeFp8LJVoLmjlW6Aw/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/YcEPmB6RDnoeFp8LJVoLmjlW6Aw/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/YcEPmB6RDnoeFp8LJVoLmjlW6Aw/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/YcEPmB6RDnoeFp8LJVoLmjlW6Aw/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/6FlNr2YjXqM" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 00:10:31 GMT</pubDate>			<dc:creator>BetsyKelleher305</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:BetsyKelleher305</comments>		</item>
		<item>
			<title>Ugurderindondurucu531</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ugurderindondurucu531</link>
			<description>&lt;p&gt;Summary: New page: Uğur Derin Dondurucu, Dondurma Reyonu, Su Sebili, Şişe Soğutucu, Şerbetlik, Yatay ve Dikey Dondurucular, Pasta Reyonu, Buz Makinesi, Beko Beyaz Eşya ve birçok marka ve ürünün sat...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Uğur Derin Dondurucu, Dondurma Reyonu, Su Sebili, Şişe Soğutucu, Şerbetlik, Yatay ve Dikey Dondurucular, Pasta Reyonu, Buz Makinesi, Beko Beyaz Eşya ve birçok marka ve ürünün satışı tarafımızca yapılamaktadır. [http://www.ugurdondurucu.com Uğur derin dondurucu fiyatları] oldukça uygun ve bütçeye göre ekonomik olarak tüketicilere sunulmuştur. Ek olarak kalite ve güven anlayışıyla [http://www.ugurdondurucu.com uğur derin dondurucu]ları tasarruflu enerji harcamasıyla da müşterilerden tam not almaktadır. Birçok model ve alternatif seçenekleriyle alanında en iyi olmanın verdiği grurla sizleri Türkiye' nin tek showroom mağazası olan bayimize bekliyoruz. http://www.ugurdondurucu.com&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/FQ2co4qeenXY7bHbPKlNSkS37fw/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/FQ2co4qeenXY7bHbPKlNSkS37fw/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/FQ2co4qeenXY7bHbPKlNSkS37fw/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/FQ2co4qeenXY7bHbPKlNSkS37fw/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/cDzVwfYvHFI" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 22:39:06 GMT</pubDate>			<dc:creator>Ugurderindondurucu531</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ugurderindondurucu531</comments>		</item>
		<item>
			<title>ZumoCast App For free IPhone three</title>
			<link>http://en.wikipilipinas.org/index.php?title=ZumoCast_App_For_free_IPhone_three</link>
			<description>&lt;p&gt;Summary: New page: Lets face it, today all of us are on the actual go. Along with new Intelligent Phones we browse the net and make use of apps to perform everything.  Many people get frustrated from getting...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Lets face it, today all of us are on the actual go. Along with new Intelligent Phones we browse the net and make use of apps to perform everything.&lt;br /&gt;
&lt;br /&gt;
Many people get frustrated from getting a phone because of the contract and never wanting in order to bind themselves to some provider if something doesn't meet their own standards for example poor coverage or maybe even poor customer support experiences. You are able to get the iphone without the contract in the united kingdom. The way this can function is by many websites that offer deals such as the iPhone with no strings attached.&lt;br /&gt;
&lt;br /&gt;
Most of times people might write this particular idea off as if it were some type of gimmick, however, what they don't realize is that Apple and many other companies NEED people to test their products and give their valued option on the products so they can improve them. Apple have to know exactly what prospective customers are going to want in the new version from the iPhone, so why don't YOU tell them?&lt;br /&gt;
&lt;br /&gt;
As an iphone owner, you may or may not know that you can to download free songs from the few various places. You can't have still did not notice the actual popularity from the Iphone, even though it has only been around a short while it looks set to be a runaway success, and for good reason-an Iphone can perform everything the Ipod does but additionally give you access to the internet and quite a handy mobile phone.&lt;br /&gt;
&lt;br /&gt;
If your love is for things upon wheels, Jelly Vehicle will get you nut products. You can drive a jelly vehicle on some squishy roads to make it to the next exit. On the other hand, park the actual jelly car trying to draw your personal path as well as make on your path through on Trace. You can draw websites and run past hurdles to reach a goal to get to the next level.&lt;br /&gt;
&lt;br /&gt;
The group of iPhone pictures has images that will be used in common software items and navigation bars associated with online portals. A lot more than 120 icons for example Refresh as well as Synchronize, Documents, Registry, Briefcase, Script, Address Book, Info, Pocketbook, Card, Hint, Tools, Lock as well as Key are usually supplied along with many other people.&lt;br /&gt;
&lt;br /&gt;
Most of us, even today can not afford to buy a 3G iphone but we are able to always manage to get 1 for just few dollars and even free by simply trying and taking advantage of the offers that a few of the great websites offer as freebies in exchange of several customer referrals. This method really is mind blowing since you may manage to get hold of some of the best Free iPhone just by following simple steps of sign up. Free iphone can simply be the very best freebie for many of those individuals who cannot really get their hands on one.&lt;br /&gt;
&lt;br /&gt;
Sometimes the perfect lyrics strike whenever you least expect them and when you dont have a pen as well as paper useful, that fantastic line could be lost with regard to eternity. LyricPad transforms your iPhone into a pen, notepad and Music player in 1. With among the best iPhone apps for musicians, pen a brand new song or even edit an existing masterpiece outrageous of your preferred tune; whenever inspiration strikes, never be confused for terms with LyricPad.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/8lJ1vE4_urghvKzy-ys24sEYSDM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8lJ1vE4_urghvKzy-ys24sEYSDM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/8lJ1vE4_urghvKzy-ys24sEYSDM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8lJ1vE4_urghvKzy-ys24sEYSDM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/_BU-w5SCPDs" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 22:12:45 GMT</pubDate>			<dc:creator>ZumoCast App For free IPhone three</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ZumoCast_App_For_free_IPhone_three</comments>		</item>
		<item>
			<title>KimballTruesdell520</title>
			<link>http://en.wikipilipinas.org/index.php?title=KimballTruesdell520</link>
			<description>&lt;p&gt;Summary: New page: Apparently everyone today is buying a PSP! This is already the most famous portable gaming system undoubtedly, and its user base just is growing. In view of this kind of, we decided it has...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Apparently everyone today is buying a PSP! This is already the most famous portable gaming system undoubtedly, and its user base just is growing. In view of this kind of, we decided it has to be useful thing to give a short look at how to get free PSP game data.&lt;br /&gt;
&lt;br /&gt;
As the popularity with the PSP grows there are a lot more people using PSP game downloading, rather than going to an electronics store to obtain games. The convenience is certainly a huge factor here, as is the dramatically lower price. To check out the newest games, all you need to complete is go online.&lt;br /&gt;
&lt;br /&gt;
Alright, no more delays: Here are three options you should use to find free PLAYSTATION PORTABLE downloads.&lt;br /&gt;
&lt;br /&gt;
Option #1 - Free of charge PSP Game Downloads&lt;br /&gt;
&lt;br /&gt;
As a first stage, a lot of people looking for free PSP downloads simply employ google search. They enter &amp;quot;free PLAYSTATION PORTABLE downloads&amp;quot; into Google, etc. and have a look.&lt;br /&gt;
&lt;br /&gt;
Do they have just about any luck?&lt;br /&gt;
&lt;br /&gt;
Unfortunately, they usually do not really. Plenty of websites feature &amp;quot;free PSP downloads&amp;quot;, but few deliver with this promise. There are issues you should be aware of first.&lt;br /&gt;
&lt;br /&gt;
For instance, on these rarely moderated sites you will find there's significant risk of receiving infected files, viruses and spyware. These websites are popular for having users in which upload infected and negative files. Adding insult to injuries, the download speeds are very very slow on these kind of sites. Without any real investment, server capacity and bandwidth suffer, and so will you should you try to get downloads available from these sources.&lt;br /&gt;
&lt;br /&gt;
Corrupt, unplayable files are an additional problem here. As if it wasn't bad enough to have taken forever to acquire a file, you may well finally get it only to find it's not going to work - having wasted your time and causing you stress. Obviously, we're not going in order to recommend you use these sites. Approach them with great caution and your own risk.&lt;br /&gt;
&lt;br /&gt;
Option #2 - Obtaining Free PSP Downloads&lt;br /&gt;
&lt;br /&gt;
After giving up about the first option, hopefully with your device still intact, some try for this kind of. There are membership-only sites offering PSP downloads. You can download whatever you want, whenever you want (such as PSP games, of course), for a monthly price, generally around $30.&lt;br /&gt;
&lt;br /&gt;
The next option will always be better and lets you obtain the same PSP downloading, so we'll end the discussion of option #2 here.&lt;br /&gt;
&lt;br /&gt;
Option #3 - How to locate PSP Downloads&lt;br /&gt;
&lt;br /&gt;
Last, but certainly not minimum, this is the best option for PSP gamers. This one we can actually recommend to you for any PSP game downloads resource.&lt;br /&gt;
&lt;br /&gt;
Also membership based, there are sites which usually also offer &amp;quot;whatever, whenever&amp;quot; downloads to members for a one time fee. Rather than a monthly fee which really adds up over the course of a year, you are billed just the once and can begin downloading all the movies and games the heart desires, whenever it is convenient to suit your needs.&lt;br /&gt;
&lt;br /&gt;
Membership in these sites costs anywhere between $35 and $50, and include the software you will need to get your downloads where you'll need them to be: your PSP. You'll find a link rigtht after this article which may point you towards a few of these sites, where you can learn more and even get a free trial membership. Setup is quick and easy - it will take you roughly 10 min's to be all ready to go.&lt;br /&gt;
&lt;br /&gt;
Unlike the sites discussed in option #1, these sites are manage by companies who spend money on them. They have the motivation to make sure their customers are well taken care of so that their reputation is strong and they also keep getting new clients. Because of this, they make sure downloads are fast and data are checked before being provided for download, as well as ensuring access to every one of the latest PSP games.&lt;br /&gt;
&lt;br /&gt;
Watch for sales in stores to plummet as a lot more consumers choose to download PSP games. Being that PSP game downloads are a lot more convenient, as well as cheaper than looking for them at stores, this trend is sure to keep. It's a great solution to keep your PSP full of the latest in motion pictures and games. Happy gaming! [http://www.free-psp-downloads.com read more]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/9BKIDZFzTgT24Cy5G0Zi04FEMdg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9BKIDZFzTgT24Cy5G0Zi04FEMdg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/9BKIDZFzTgT24Cy5G0Zi04FEMdg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9BKIDZFzTgT24Cy5G0Zi04FEMdg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/ynLLqdduoJ4" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 21:04:59 GMT</pubDate>			<dc:creator>KimballTruesdell520</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:KimballTruesdell520</comments>		</item>
		<item>
			<title>KulpSites723</title>
			<link>http://en.wikipilipinas.org/index.php?title=KulpSites723</link>
			<description>&lt;p&gt;Summary: New page: Wedding photography San antonio can be gifted professional photographers along with abilities that could impress you, with all the artistic contact and also the expertise they've attained ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Wedding photography San antonio can be gifted professional photographers along with abilities that could impress you, with all the artistic contact and also the expertise they've attained through the prior years these people cope with marriages high professionalism and reliability, they slowly move the lovers to consentrate forward about the photographs that they can ‘d like to catch right then and there and compile an inventory to enable you to examine these people away since its the particular couple’s day time and their wants have to be followed, in any other case wedding photography San antonio is actually  always ready using zoom lens to take a look through the inner thoughts you are experiencing on your morning and turn it into a series of photographic thoughts. &lt;br /&gt;
With many numerous years of expertise guiding your camera they've got received the immense knowledge of even now images, based on their know-how, their particular staff is dedicated to deliver an original, expressive wedding photography that captures your event’s finest occasions as well as expression.&lt;br /&gt;
Top quality may be the primary aim of these group as it's well reflected by means of their particular operate. Their continuous efforts offer solutions as well as best the majority of concern on their consumers. They are all over the place along with nowhere fast, they shall be generally there right away in the nighttime up until the summary, they may be also intended for vacation spot marriage ceremonies because the entire world becomes a world-wide small town, a more substantial pct of marriage ceremonies come about from the couple’s home region and several times the couple’s residence region along with wedding photography Dallas can be very happy to tell their potential customers that they may keep to the couples right up until their particular desire vacation spot.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/UrtjZ-roNlb142uWMrUqXH4_OlU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/UrtjZ-roNlb142uWMrUqXH4_OlU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/UrtjZ-roNlb142uWMrUqXH4_OlU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/UrtjZ-roNlb142uWMrUqXH4_OlU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/bDjSRa4W4Sg" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 20:24:08 GMT</pubDate>			<dc:creator>KulpSites723</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:KulpSites723</comments>		</item>
		<item>
			<title>CorriveauSproul226</title>
			<link>http://en.wikipilipinas.org/index.php?title=CorriveauSproul226</link>
			<description>&lt;p&gt;Summary: New page: The Benefits Of Draping Backyard Cord Lighting Effects   string lights are found to make livelier any kind of festive occasion - from birthday celebrations to wedding ceremonies and ritual...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The Benefits Of Draping Backyard Cord Lighting Effects&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
string lights are found to make livelier any kind of festive occasion - from birthday celebrations to wedding ceremonies and rituals. Not because they are the cheap cost decoration kind, but because of the fact that they can be utilized in every arrangement and the flexibility they offer in arranging them.&lt;br /&gt;
&lt;br /&gt;
It all depends on the creative imagination used in the arrangement of the lights that make them more enjoyable to see.&lt;br /&gt;
&lt;br /&gt;
There are various factors you have to consider before going on to finalize the [http://www.agreensupply.com/LED-String-Lighting/ aGreensupply string lights] to be used. You need to consider the theme of the event, the area of the landscape and the type of lighting to be used and the occasion area that needs to be adorned - all these needs to be considered before hand.&lt;br /&gt;
&lt;br /&gt;
Here are a few tips for hanging the [http://www.agreensupply.com/shop/ aGreensupply string lights] for an upcoming occasion.&lt;br /&gt;
&lt;br /&gt;
- Planning: Hanging the outdoor string lighting needs to have some planning to be done. You must ensure that, there is an electrical receptacle for the lights. All the heavy-duty extension cords from the electrical outlet ought to be checked prior to use. Ensure the receptacles' circuit is evaluated to handle the combined amperes of all light strings attached to it.&lt;br /&gt;
&lt;br /&gt;
- Measurements: Have knowledge of the landscape and where the lights are to be used. You can use -a long measuring tape and take the measurements of doors, windows, bushes or trees, where you plan to hang the lights. Based on these measurements you can figure out the lengths of light strings.&lt;br /&gt;
&lt;br /&gt;
- Testing the lights: You must make sure that there are no lights on bulbs are missing in the string and there are no broken or worn out bulbs or lights. If any flaws found in the bulbs, arrange for replacement. In case -a broken wire are observed, replace the string. This needs to be before you hang on the lights. When the checking is finished and all the necessary changes are done, the string is ready to be hanged. Now you can re-test the string to check whether it is working.&lt;br /&gt;
&lt;br /&gt;
- Using ladder: This depends on the place and the height where you ought to hang the string light. You can make use of a stepladder or an extension ladder to hang the lights at the ideal place. Before, this is necessary for you, ensure that the ladder is placed strong on flat ground and at an angle that it is easy and safe to climb.&lt;br /&gt;
&lt;br /&gt;
- Use Clips: In case to choose to put the lights along the gutters or the roof, you need to use appropriate clips to keep them attached. In case you wish to attach the lights to window trim and any other similar parts, tube light clips or plastic material clips can be utilized.&lt;br /&gt;
&lt;br /&gt;
All these suggestions and the innovative hints used in arranging the lights can help you in making your outdoor celebration be totally distinct and the most great one. Though such celebrations are intended of get together, such small decorating tip can make them more unforgettable.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/mSjqm3u3yZ-kU_JmfSWI7FeiRsA/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/mSjqm3u3yZ-kU_JmfSWI7FeiRsA/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/mSjqm3u3yZ-kU_JmfSWI7FeiRsA/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/mSjqm3u3yZ-kU_JmfSWI7FeiRsA/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/fWeSXsoYbPI" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 19:39:58 GMT</pubDate>			<dc:creator>CorriveauSproul226</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:CorriveauSproul226</comments>		</item>
		<item>
			<title>HoughtonKidder363</title>
			<link>http://en.wikipilipinas.org/index.php?title=HoughtonKidder363</link>
			<description>&lt;p&gt;Summary: New page: Today's consumers are realizing that no wood or wood product exposed to weather is going to become completely maintenance-free. Even exotic woods like Ipe demand periodic cleaning and seal...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Today's consumers are realizing that no wood or wood product exposed to weather is going to become completely maintenance-free. Even exotic woods like Ipe demand periodic cleaning and sealing because the all-natural oils inside the wood dry out. All exterior lumber applied in [http://www.deck-cleaner.co.uk/ Cleaning a deck] ought to be maintained each and every year to protect it from the components and ground in dirt.&lt;br /&gt;
&lt;br /&gt;
Composite lumber varies from manufacturer to manufacturer, nevertheless it seems that all of the preferred ones include wood particles (these ground particles are known as &amp;quot;wood flour&amp;quot; by the industry). That implies that any of these particles on or near the surface in the board, it doesn't matter what they are mixed with, will react to Mother Nature the same way all wood does. Graying and staining are frequent problems - plus the stuff of nightmares for deck owners. Manufacturers are getting calls just about every day from finish users about these difficulties, and deck restoration contractors are stepping in with all the fix.&lt;br /&gt;
&lt;br /&gt;
Cleaning composite decks is very important to help keep the material looking its finest. Appropriately cleaning composite decks should really be completed having a composite wood cleaner that is created particularly for these exceptional materials. Some manufacturers have recommended applying bleach or oxygenated bleach to clean the wood, however the results have already been varied. Most pressure washing contractors who do deck renewal are acquiring results via items produced specially for this issue, including Flood's Composite Wood Cleaner. The key to this distinct product is inside the surfactants and cleaning chemicals in its formula.&lt;br /&gt;
&lt;br /&gt;
This guide will offer you the basic actions that really should be made use of to acquire the most effective results when cleaning composite deck materials.&lt;br /&gt;
&lt;br /&gt;
Preparing the composite deck: Sweep debris like leaves, twigs and dirt off the deck 1st. Then rinse off the composite lumber to cool it off and remove heavy built up deposits of dirt and mud. Rinsing off the composite deck initial will cool the surface and avoid the possibility of flash drying the composite cleaner when it's applied. Also wet down plants and grass about the deck and if vital, Cover plants, grass, concrete and any other locations you do not want the composite cleaner getting on.&lt;br /&gt;
&lt;br /&gt;
Take away any stains on composite decks 1st! Use oxalic, citric or phosphoric acid-based cleaners to remove rust stains from metal furnishings. These will also assist get rid of leaf stains.&lt;br /&gt;
&lt;br /&gt;
Use commercial degreasers containing propylene glycol, sodium hydroxide, and many detergents for removing grease and oil stains.&lt;br /&gt;
&lt;br /&gt;
Spot removers or mineral spirits might be employed cautiously on stubborn grease or oil stains but really should be washed off [http://www.deck-cleaner.co.uk/ Deck Cleaner] with water, as it can damage the grain pattern. Spot removers ordinarily include petroleum distillates, xylene, methanol, acetone, or other natural solvents. Use caution if the composite lumber has embedded color, as some solvents may influence the look. As normally, test your cleaner on an inconspicuous spot.&lt;br /&gt;
&lt;br /&gt;
To remove light mildew wash your composite deck periodically having a cleaner that contains or is mixed with Sodium Hypochlorite.&lt;br /&gt;
&lt;br /&gt;
The cleaning procedure:&lt;br /&gt;
&lt;br /&gt;
Apply your composite deck cleaner on the railings and floor in manageable sections. Cleaning too massive of an region at a time could let the composite cleaner to dry on the surface which may lead to discoloration in some materials. The moment the composite cleaner has sat on the surface in line with the directions, very carefully power wash the surface within the path from the grain, making use of much less than 800 PSI. Use the pressure washer to &amp;quot;rinse&amp;quot; the surface. Avoid holding the nozzle too close towards the composite surface or holding it in any one particular spot as well long. Hold the pressure wand about 8&amp;quot; away from the surface and &amp;quot;sweep&amp;quot; it off inside a rinsing motion. Use a &amp;quot;golf swing&amp;quot; movement, and stay clear of washing every square inch of your surface. Maintain the wand moving smoothly over the surface to avoid leaving marks. Correct technique determines the outcomes, so take some time to practice when you are in a position to. When you may have completed that section, treat the next location and continue till the job is completed.&lt;br /&gt;
&lt;br /&gt;
For normal maintenance, rinse off your composite deck periodically having a hose. Even if your deck appears clean, it's vital to stop build-up of pollen along with other debris. Mildew stains may perhaps occur where moisture, pollens, and/or dirt are present. Mildew demands a food supply to develop, which can be grass, pollens, dirt, debris, wood and wood resins.&lt;br /&gt;
&lt;br /&gt;
To repair scratches, nicks, cuts and grooves in most composite decking supplies you may try utilizing a brass wire brush. Brushing will have to be consistent together with the grain with the composite material as well as the brushed region will climate back in approximately 8-10 weeks. Be sure you try this in a hidden location initially! Some supplies could turn out to be discolored or damaged from wire brushing.&lt;br /&gt;
&lt;br /&gt;
High-pressure washing of composite decks will not be vital or advisable. Rather, hire a appropriately trained pressure washing organization to complete it appropriately and safely. Or in the event you should do it your self, use the proper-strength composite lumber cleaners to perform every one of the work for you personally. Then you just RINSE utilizing your pressure-washer. Doing it the best way suggests utilizing your pressure washer to agitate slightly with [http://www.deck-cleaner.co.uk/ Deck Stripper] pressure and HIGH water volume. Use the pressure washer responsibly. An excessive amount of pressure on the surface of composite lumber can cause damages.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/W-2Knu5IMU8z1-2Mny2eaTAAkac/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/W-2Knu5IMU8z1-2Mny2eaTAAkac/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/W-2Knu5IMU8z1-2Mny2eaTAAkac/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/W-2Knu5IMU8z1-2Mny2eaTAAkac/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/oLWzH4dj9Bw" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 19:28:39 GMT</pubDate>			<dc:creator>HoughtonKidder363</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:HoughtonKidder363</comments>		</item>
		<item>
			<title>HussainParsley525</title>
			<link>http://en.wikipilipinas.org/index.php?title=HussainParsley525</link>
			<description>&lt;p&gt;Summary: New page: Toronto is probably the most stimulating in addition to radiant urban centers of The us. Featuring connected with exceptional meal, way of life, activity, in addition to evening existence,...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Toronto is probably the most stimulating in addition to radiant urban centers of The us. Featuring connected with exceptional meal, way of life, activity, in addition to evening existence, they have come in par along with some of the most well-liked towns involving The united states along with Europe. Flourishing with things to do and pleasure, Toronto currently will be garnering fantastic awareness as being a owning a home desired destination as well. Unique Toronto business real estate property or even condo rentals easily obtainable in Toronto, your expense within real-estate here [http://www.CondoCashBack.ca Commission Condo Cash Back Home] appears really guaranteeing ultimately. Aside from ensuring great returning with your capital, choosing a Toronto condo likewise gives on several benefits as a possible expense selection:&lt;br /&gt;
&lt;br /&gt;
Affordability- Brand-new construction condominiums on the market or perhaps proven condo rentals for sale in Toronto; both equally establish a reasonable expenditure choice in comparison with 1 home device. A new condominium acquire can be completed in the simple budget as opposed to a new stand alone model.&lt;br /&gt;
&lt;br /&gt;
A smaller amount maintenance- like a multiple dwelling model your repair expenditures are generally distributed because of the each of the products hence on lessening the actual bills. Each and every Condo in Toronto comes with an affiliation looking after the actual servicing perform, sparing you through the jobs taste solving this roof or even keeping the actual backyard. The many frequent regions usually are covered with the contemporary society and also you or maybe the tenants need to worry directly about this rooms.&lt;br /&gt;
&lt;br /&gt;
Local rental options- a new Toronto residence would certainly fetch that you good leasing benefit, a good addition towards the price gain of this funds.&lt;br /&gt;
&lt;br /&gt;
It's also possible to spice up yourself through the use of your own Toronto condominium as your current residential alternative, enjoying numerous gains:&lt;br /&gt;
&lt;br /&gt;
Safety- Vacationing in any variable house device is actually fairly a good deal better than the usual stand alone option. Closeness for your others who live nearby is definitely an edge if you travel a lot or even are living on it's own. More common places as well as shared partitions however narrowing your own solitude, assists to guard your own hobbies versus several criminal offenses.&lt;br /&gt;
&lt;br /&gt;
Sociable circle- A new separate residence absolutely gives you good level of privacy, but also eliminates your own social friendships as well as wonder. Surviving in a new Toronto condominium, you need to discuss the most popular regions such as damages, laundry location, yard and so on. while using the other people, providing a good amount of possiblity to recognize the neighborhood friends effectively. You love it your excitement connected with interpersonal circle however your current solitude is actually [http://www.CondoCashBack.ca Commission Condo Cash Back Home] managed inside walls of your property.&lt;br /&gt;
&lt;br /&gt;
Toronto, the city -- Toronto is surely an fascinating along with ripped town. Moving into Toronto you've got fantastic experience of first class features apart from various modern day and also conventional art museums, attractive to the cosmetic feelings at the same time. Being inside Toronto you are able to experience the exposure to the present day lifestyle even though maintaining near your current origins.&lt;br /&gt;
&lt;br /&gt;
Whether you want to put money into real estate or perhaps you're planning to reside inside it, investing in a house with Toronto is a good notion. Not simply this assures appealing love of your cash but also exposes you to definitely the actual joys of your metropolis from par with the worldwide expectations.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/wEdjZ75Vna96kF8CbyjFk_EIZLA/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wEdjZ75Vna96kF8CbyjFk_EIZLA/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/wEdjZ75Vna96kF8CbyjFk_EIZLA/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wEdjZ75Vna96kF8CbyjFk_EIZLA/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/QkpsLgcEoas" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 19:15:02 GMT</pubDate>			<dc:creator>HussainParsley525</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:HussainParsley525</comments>		</item>
		<item>
			<title>Free rs client 26</title>
			<link>http://en.wikipilipinas.org/index.php?title=Free_rs_client_26</link>
			<description>&lt;p&gt;Summary: New page: Maybe you have though of using more than 2 hundred thousand people online at the same time? It seems like a gamers dream however it is true. Runescape, controlled by Jagex, is a MMORPG, wh...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Maybe you have though of using more than 2 hundred thousand people online at the same time? It seems like a gamers dream however it is true. Runescape, controlled by Jagex, is a MMORPG, which represents Massive Multiplayer On the web Role Playing Game. You do not have to subscribe, buy the game or obtain something Runescape features a free place, so people can check their [http://www.runescapeautoclickers.com/privacy-policy RS CLIENT]. Runescape is scored on top five greatest MMORPG and the group keeps growing daily. It is top ranked because of several reasons that make it one of many best MMORPG: having an old style with epical views, interact with people throughout the world, the regular updates of the activity and [http://www.runescapeautotyper.com auto typer]. Runescape is a Java-based activity, so it has no graphics that can call people attention. The great benefit of being a Java-based activity is that the player doesnt have to download the game or pay for it, so that they can test it quickly just likely to the webpage, building their account, and log in. Additionally, it has a member place that provides you more benefits, entertainment, and better design than on member area. However, Runescape has very good design if you are Java-Based activity with an ancient theme due to being a java-based game it does not let Jagex make the design better. Of course you should try the [http://www.runescapeautoclickers.com/tag/rs-client Autoclicker].&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/4HTg9iQ-8rrWrIssgbe3gb9dZUo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4HTg9iQ-8rrWrIssgbe3gb9dZUo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/4HTg9iQ-8rrWrIssgbe3gb9dZUo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4HTg9iQ-8rrWrIssgbe3gb9dZUo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/RFd-so2n-9E" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 18:54:08 GMT</pubDate>			<dc:creator>Squier296</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Free_rs_client_26</comments>		</item>
		<item>
			<title>WinnieCravens482</title>
			<link>http://en.wikipilipinas.org/index.php?title=WinnieCravens482</link>
			<description>&lt;p&gt;Summary: New page: From different surveys, it is seen that the number of customers taking payday loan as well as payday lending companies are increasing frequently. If you are a person taking the payday loan...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;From different surveys, it is seen that the number of customers taking payday loan as well as payday lending companies are increasing frequently. If you are a person taking the payday loan for the first time or want to gather information regarding payday loan, then this article will be of great help to you.&lt;br /&gt;
 &lt;br /&gt;
 Definition of payday loan:-&lt;br /&gt;
 &lt;br /&gt;
 Payday loan is a very short term loan. Usually the term is 1-2 weeks. There are other names of payday loan like - “Cash Advance”, “Paycheck loan”, “Check loans”, and “Payroll advance loans”. After you get your paycheck, the loan is to be repaid. If you cannot repay the loan amount plus lender’s charges for payday loan on your payday, you can rollover the loan amount by paying extra fees to the lender plus you have to pay the interest along with for the rollover period. So, payday loan can be termed a “Loan Sharking”.&lt;br /&gt;
 Necessity of payday loan:-&lt;br /&gt;
 &lt;br /&gt;
 By the end of the month, you may face some problems in maintaining some urgent family expenses like paying off your Medical Bills, Phone Bills, and Electric Bills, House Rent or some other utility bills. These things usually happen when you fail to maintain a proper budget at the time of getting your paychecks or not keeping your expenses up to your income limit. Hence in order to meet such urgent expenses you need a payday loan. &lt;br /&gt;
 &lt;br /&gt;
 Payday loan companies:-&lt;br /&gt;
 &lt;br /&gt;
 There are so many companies who are promoting check cashing facilities online. Besides some banks and other financial institutions also provides you with a payday loan. You can apply online for a payday loan or you can visit physically to an institution to avail a payday loan.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/5qmVI-x9poXlpPkyaZHz6G85FUU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/5qmVI-x9poXlpPkyaZHz6G85FUU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/5qmVI-x9poXlpPkyaZHz6G85FUU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/5qmVI-x9poXlpPkyaZHz6G85FUU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/fvFwh65bs-k" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 18:36:54 GMT</pubDate>			<dc:creator>WinnieCravens482</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:WinnieCravens482</comments>		</item>
		<item>
			<title>Or you possibly can take the advice that many are starting to pick up on</title>
			<link>http://en.wikipilipinas.org/index.php?title=Or_you_possibly_can_take_the_advice_that_many_are_starting_to_pick_up_on</link>
			<description>&lt;p&gt;Summary: Most of us have a thousand to take a place, they normally invest three hundred, and lose virtually all, after which they merely have 600, they make investments 200 and lose it, they've 400, they make investments a hundred they usually lose it right n&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Without it, you Will lose and lose often. The skilled of meizitang botanical slimming gel mentioned that for these who really want to drop extra pounds it ought to be carried out step by method of step, any weight lose can't be realised solely by means of one or two train,however how ought to we have an working out of it? affluent weight lose are being within the place to peer the workout routines those engage in enjoy your self doing the identical! The factor about making plans to lose is you could have a good time enjoying the game without worrying an excessive amount of about breaking the bank. what such a lot folks are really trying to lose is fat, now not weight, and a scale won't degree fat. Getting old is a pure process; the face begins to lose is younger glow. Whilst somebody is trying to drop a few weight and also you ask they how a lot weight they would like to lose often they will say 10 kilos, it is . And the frame of mind that performs not to lose has one other downside. In the same approach, a franchise which experience lose often is simply not value your money. The charge cost financial savings with out good quality lose will be carried out in many different ways. Wholesome recipes for weight lose are available everywhere. Every time there may be the opportunity to place a wager or even must you lose have it paid back due to this fact it is ones duty to determine your manner through each bookmaker and make use of it. It is vital to notice that how fast one loses weight and how much weight you lose is relative to every individual.&amp;lt;br/&amp;gt; &amp;lt;br/&amp;gt;Patients which have a considerable quantity of weight to lose usually benefits from weight reduction surgery. The problem of occurring a food regimen to determine weight lose has sparked lots of debate among fitness gurus and food plan consultants. Numerous the first kilos you [http://www.secash.de lose] are going to be water weight. A few folks spend years enjoying card video games they usually lose usually, particularly those who spend six figures to buy right into a game, and lose within the first round of any given tournament. Another quote that gives actual sympathy is, Those we love and lose are along with us in heart, eternally with us in memory. burning applications, which take weight loss to an entire new stage by means of ensuring that every pound you lose is mostly fat. As an illustration, the load that folk lose is generally round their butt, higher legs and in the mid section. But greater than doubtless the load lose is just a byproduct. Every pound you lose can enhance your health. Weight lose can occur both by means of restricting the consumption of calorie or by burning extra calories as in comparison with the calorie ate up and the perfect solution is to have a combination of both. This is very important as even a slight lose can prove to be actually fatal in this case. Child garments that are too lose can be now not a good choice for the surplus elements of the clothes could get tangled with the tubes which might be attached to the child's body. It's one of the best to modification the way you notice weight reduction, reducing weight is normally something that may be finished over some time period, taking a weekly plan on the quantity of weight you want to lose will be of help.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Vw0Q4CZ3XwlDNZfCpO-yfznm3Rk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Vw0Q4CZ3XwlDNZfCpO-yfznm3Rk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Vw0Q4CZ3XwlDNZfCpO-yfznm3Rk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Vw0Q4CZ3XwlDNZfCpO-yfznm3Rk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/4jeNXKPa440" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 18:33:04 GMT</pubDate>			<dc:creator>Mzorra9</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Or_you_possibly_can_take_the_advice_that_many_are_starting_to_pick_up_on</comments>		</item>
		<item>
			<title>StillSpurgeon903</title>
			<link>http://en.wikipilipinas.org/index.php?title=StillSpurgeon903</link>
			<description>&lt;p&gt;Summary: New page: Moon Breakers is really good game.&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Moon Breakers is really good game.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/iM9x8Lcy_kIJJmQdYuXXPrbB49w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iM9x8Lcy_kIJJmQdYuXXPrbB49w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/iM9x8Lcy_kIJJmQdYuXXPrbB49w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iM9x8Lcy_kIJJmQdYuXXPrbB49w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/UwkvuXmI0Es" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 18:28:35 GMT</pubDate>			<dc:creator>StillSpurgeon903</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:StillSpurgeon903</comments>		</item>
		<item>
			<title>ClotildaHines249</title>
			<link>http://en.wikipilipinas.org/index.php?title=ClotildaHines249</link>
			<description>&lt;p&gt;Summary: New page: Apple Supplements  will in addition assist you to undoubtedly administration food cravings, enhance your metabolic process, enhance vitality in addition to more- just about all without acq...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Apple Supplements  will in addition assist you to undoubtedly administration food cravings, enhance your metabolic process, enhance vitality in addition to more- just about all without acquiring stimulants! Researchers have verified the standard not enough 12.Three or more lbs by 50 percent months!&lt;br /&gt;
&lt;br /&gt;
The actual Africa Mango emanates from the actual Irvingia Gabonesis woods and it's also indigenous to Western Video cameras. The corporation might be a deceitful because the all types of berries aren't actually your Apple, despite the fact that it really is comparable to the particular Apple that individuals are widely-used to inside the Oughout.  Together with the Africa Pear is not only contained in Photography equipment, additionally it is within many other around the world places.&lt;br /&gt;
&lt;br /&gt;
How do Camcorders Pear enable you to lose fat? Cameras Pear aids increase leptin consciousness. Lepton is really a hormone imbalances that diminishes food cravings indicators in the mind, consequently handling intake of food. Overweight or even extra fat individuals are thought to generate a whole lot lepton the pounds is actually developed creating the actual endrocrine system less capable inside chopping food cravings. Picture to not get the actual cravings for everyone nighttime treat foods, men and women tendencies with regard to harmful foods. Using Africa Mango you'll be able to aid in fighting folks very poor diet plan off. Even though physical exercise might greatly increase fat loss, you don't need to that you can work as well as exercise routine in any way.&lt;br /&gt;
&lt;br /&gt;
Your Africa mango might seem to be another fascinated merchandise to produce hype and large bucks with regards to firms. Nonetheless, using sturdy support originating from Doctor. Mehmet Oz of, which has been introduced around the The popular host oprah Display quite a few instances, an item seems far more legitimate. Produce.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/nCfyBqB_K-CVSJRz41J-9FKlSU4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/nCfyBqB_K-CVSJRz41J-9FKlSU4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/nCfyBqB_K-CVSJRz41J-9FKlSU4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/nCfyBqB_K-CVSJRz41J-9FKlSU4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/RjfvCxyXyA0" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 18:09:45 GMT</pubDate>			<dc:creator>ClotildaHines249</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ClotildaHines249</comments>		</item>
		<item>
			<title>HungerfordModica36</title>
			<link>http://en.wikipilipinas.org/index.php?title=HungerfordModica36</link>
			<description>&lt;p&gt;Summary: New page: Sibling Embroidery Equipment Details To learn  There are various connected with anyone who similar to do to accomplish adornments. Even so, you will find a wide variety of manufacturers ou...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Sibling Embroidery Equipment Details To learn&lt;br /&gt;
&lt;br /&gt;
There are various connected with anyone who similar to do to accomplish adornments. Even so, you will find a wide variety of manufacturers out there. One particular manufacturers is usually [http://www.cristiangriggio.com brother embroidery machines]. Here are several points all of us discovered these individuals.&lt;br /&gt;
&lt;br /&gt;
Quite a few which buy that brand point out that they enjoy all the jobs they've already got about it. Usuallu when you use this kind of, in an effort to along with and the feel are simply just appropriate. They've got various designs regarding different requirements. You may soon find out this particular as well.&lt;br /&gt;
&lt;br /&gt;
Because time is now with, you will feel we now have many of them who come across they have produced technologies to become unique. Since technological know-how changes, they remember to alter by using it so that you can are becoming essentially the most user-friendly equipment that may be nearly this criteria on the instances.&lt;br /&gt;
&lt;br /&gt;
Most significant stuff folks who complete adornments seek out will be that they look for stuffs that undoubtedly are a little bit within the rapidly side. The fact that entire world performs is that you must accomplish far more in order to make additional money which is the reason they are many boosting efficient.&lt;br /&gt;
&lt;br /&gt;
A number of you might say that you do not realize what types of appliance you will definitely have to have. You cannot understand when they get one thing for the degree. On the other hand, you are able to know that in most cases, they've products for every level of particular person.&lt;br /&gt;
&lt;br /&gt;
Whether or not that you are some sort of novice or a heightened individual, you'll discover they've already a little for you. This is why quite a few get traded for this make of these types of. Permanently, it is possible to perform the job in addition to done effectively as an example. And so, any time pick a single, you need to select Brother Embelleshment Equipment for your desires.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/9h0IZn64gpF7wlPXnWkE8OQTY34/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9h0IZn64gpF7wlPXnWkE8OQTY34/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/9h0IZn64gpF7wlPXnWkE8OQTY34/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9h0IZn64gpF7wlPXnWkE8OQTY34/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/Wg3hAAHoebo" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 17:17:53 GMT</pubDate>			<dc:creator>HungerfordModica36</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:HungerfordModica36</comments>		</item>
		<item>
			<title>GloryVictor128</title>
			<link>http://en.wikipilipinas.org/index.php?title=GloryVictor128</link>
			<description>&lt;p&gt;Summary: New page: At a single time not also long ago whenever music maker programs were incredibly costly and also demanded substantial computing systems to operate. Currently, nonetheless the opposite hold...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;At a single time not also long ago whenever music maker programs were incredibly costly and also demanded substantial computing systems to operate. Currently, nonetheless the opposite holds true. Numerous computer software designers have produced good high quality low expense music-making programs for the sophisticated consumer and also the newbie. Making [http://www.broadjam.com/software/ music software programs] that was the moment an extremely difficult activity to understand and also function at this time needs an incredibly minimal time to be in a position to up and then operating in composing your personal songs.&lt;br /&gt;
&lt;br /&gt;
Writing during the past necessary a extensive comprehension of beat, tempo, timing, notes and rhythm. With the new music maker programs, one requirements to merely set a course with all the software application it really is going to assist you in producing high quality musical sounds. Rather than needing to comprehend to be able to master an instrument such as violin, guitar or piano, contemporary musical composers need to only comprehend the restriction of the software application that they use to produce their very own electronic digital music.&lt;br /&gt;
&lt;br /&gt;
Computer-aided composing desires a person to only think about their Mac or Computer as a musical instrument. Exactly where at one time you may have thought about hiring an orchestra or band to execute your work, you'll be able to now assemble computerized virtual instruments such as drums, guitar, horns, violin, piano, and woodwinds ideal on your pc desktop using absolutely nothing greater than add-ons.&lt;br /&gt;
&lt;br /&gt;
Although only your personal computer system is necessary to become able to create music employing your keyboard and mouse, incorporating the MIDI (Musical Instrument Digital Interface) controller, drum pads and guitars connected directly in to the laptop or computer method can quickly obtain final outcomes far above what any composer not employing a music maker plan could achieve.&lt;br /&gt;
&lt;br /&gt;
Most [http://www.broadjam.com/software/ best music software] , even extremely reasonably priced sorts consist of a digital audio operates (DAW), allowing you the capability to modify ones function and start arrangement on the composition to become able to strengthen its completed product. In addition, incorporated within the music maker computer software application are pre-recorded loops of music letting you be able to layer additional top quality sounds, voice and instruments to your musical composition.&lt;br /&gt;
&lt;br /&gt;
Beginning off with a fundamental music maker program can be a plausible alternative. Spending adequate time to comprehend the composing software you will be aware, depending on your own input and expertise, exactly where the restrictions of the composing program are limiting you. that knowledge you'd know it is time to go and spend more funds to buy precisely what you'll need boost your musical writing compositions. Purchasing add-ons most suited to your individual composing kind should only definitely be accomplished following you fully grasp precisely what peripheral devices you'll need to have.&lt;br /&gt;
&lt;br /&gt;
Most of songs accessible towards the public, created by musicians, use the exact very same software identified in several music maker programs. Electronic recorded sound on music-making plan applications could be shared with other like-minded musicians simply by attaching it to an e-mail along with receiving them to uploaded into their individual composing software applications. You are no longer restrained to composing along with your fellow musicians by becoming inside the exact same studio together.&lt;br /&gt;
&lt;br /&gt;
Interested in creating your personal music from dwelling?&lt;br /&gt;
&lt;br /&gt;
Discover far more concerning the hottest music producing programs out there for all kinds of music. Like what prime hip-hop and rap producers in NYC use to generate music and [http://www.broadjam.com/software/ professional] .&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/wA5kz8BgaT3wgpfzEf7Q72IMcz4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wA5kz8BgaT3wgpfzEf7Q72IMcz4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/wA5kz8BgaT3wgpfzEf7Q72IMcz4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wA5kz8BgaT3wgpfzEf7Q72IMcz4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/CuV3T15Iyeg" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 16:55:58 GMT</pubDate>			<dc:creator>GloryVictor128</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:GloryVictor128</comments>		</item>
		<item>
			<title>LipseyCluff157</title>
			<link>http://en.wikipilipinas.org/index.php?title=LipseyCluff157</link>
			<description>&lt;p&gt;Summary: New page: These days, a child clothing designer is not a longer confined to designing baby clothes that conform to baby dresses guidelines inside terms of functionality plus components selected, yet...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;These days, a child clothing designer is not a longer confined to designing baby clothes that conform to baby dresses guidelines inside terms of functionality plus components selected, yet take it a notch higher by experimenting and integrating style with function plus using luxurious components like cashmere, angora, or the many breathable cotton that were when utilized only in adult wear.&lt;br /&gt;
&lt;br /&gt;
A &amp;lt;strong&amp;gt;baby clothing&amp;lt;/strong&amp;gt; designer now uses a range of styles plus components that may include the timeless designs of yester-year with all the classic designs of the now generation and of course they might furthermore employ the designs which evolve off their own imaginations, those which they will hope usually ignite a trend towards their own personal design. Above all else they are designers thus it stands to reason what works perfectly for baby clothing usually translate into clothing for adults, kids plus babies alike.&lt;br /&gt;
&lt;br /&gt;
Consumer studies plus child clothing sales will only testify to the truth that more and more parents are spending more money for their babies' dresses plus alternative accessories.As well as cash it is watched that parents of this time are more interested inside their infants clothing plus accessories than they ever were in the passed whether that has to do with all the supply of contents that have been not around before or parents have developed a more sophisticated taste than previous parents.&lt;br /&gt;
&lt;br /&gt;
It could be which designers at this point inside our history are more concerned than ever before thus consequently there are more and more baby clothing available now than at any other time. This trend is further produced stronger by the emergence of baby clothing lines of recognized designers, or an expanded line of their prevalent clothes plus clothing accessories.&lt;br /&gt;
&lt;br /&gt;
Indeed, baby clothing designers are all the rage nowadays incredibly with proud parents who just wish the greatest for their babies. This is specifically evident inside the steady expansion of prevalent design houses into the baby clothing company, to the delight of faithful followers of their designs whom equally happen to be parents.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;strong&amp;gt;Baby Clothing Designer Requirements&amp;lt;/strong&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Today, there are companies that permit parents or merely about anybody to shape baby clothes based about their own designs which are then actualized into baby clothes. These designs are incorporated with baby wear standards like snap or switch place, fabric, sizing as well as the like to make clothes more functional yet very personalized. This, yet, may be quite pricey due to the specific design of baby clothes which firms provide inside especially limited quantities.&lt;br /&gt;
&lt;br /&gt;
However, not just about anybody is a bubas clothing designer because being such requires technical know-how to provide designs which work. Currently, popular designers whom have produced a name for themselves inside the clothing industry today buying baby clothes lines which mimic their known style which has earned them their countless fans which today translate to their babies.&lt;br /&gt;
&lt;br /&gt;
Aside from technical know-how and popularity, a baby clothing designer additionally acquires expertise by experience that can just come with years spent designing baby clothing and overseeing the manufacturing of such. There are equally very specialized guides that designers can join into to further better their clothing design skills that focus more of baby clothing shape, to include safety, function, comfort, ease and proper sizing.&lt;br /&gt;
&lt;br /&gt;
With the advance of years, designers have different types of contents to work from today, that adds a entire modern dimension to designing little ones clothing plus with all the added bonus of being capable to shape baby clothing with hypo-allergenic materials. These give parents another avenue whenever ordering baby clothing.&lt;br /&gt;
&lt;br /&gt;
Many of the greatest designers inside the globe now design baby clothing and where once it was considered because a throw away item, something which possibly a designer did when she became expecting or if somebody they knew asked for. Now it really is a world broad enterprise plus as much thought plus attention to detail might go into designing babies clothing because for an ensemble that can 1 day be enjoyed found on the cat walks.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ajs4a6qn7W-6_iDNUIj4W3N6t3M/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ajs4a6qn7W-6_iDNUIj4W3N6t3M/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ajs4a6qn7W-6_iDNUIj4W3N6t3M/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ajs4a6qn7W-6_iDNUIj4W3N6t3M/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/mM8Pj7WO6zs" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 16:50:05 GMT</pubDate>			<dc:creator>LipseyCluff157</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:LipseyCluff157</comments>		</item>
		<item>
			<title>JennMars406</title>
			<link>http://en.wikipilipinas.org/index.php?title=JennMars406</link>
			<description>&lt;p&gt;Summary: New page: In this article I hope to explain how one can play the best DVD's on the Nintendo Wii. Although the Nintendo Wii is a wonderful multimedia system you can find one thing that holds it back ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;In this article I hope to explain how one can play the best DVD's on the Nintendo Wii. Although the Nintendo Wii is a wonderful multimedia system you can find one thing that holds it back coming from being one of the best multimedia controllers around and that's that it does not play DVD's. Nintendo wanted to solely always be thought of as any gaming large and therefore decided out of adding a Video player for their standard system.&lt;br /&gt;
&lt;br /&gt;
Luckily for many people however, quite a few pretty good people were competent to come up with a manner in which you could engage in DVD about the Wii. Right now normally this particular consisted of adding a mod chip to your Nintendo wii game console, but the challenge with this meant your mod chip voided any manufacturer's warranty that may have already been still good. [http://www.prlog.org/10788492-play-movies-on-wii-learn-how-to-play-movies-on-wii.html play dvd on wii]&lt;br /&gt;
&lt;br /&gt;
Now however you can play DVD on the Nintendo wii without the need of any mod chip and this means your guarantee will in truth stay in one piece.&lt;br /&gt;
&lt;br /&gt;
The first step is usually to install the particular homebrew funnel on your Wii console; this is a relatively straight forward process. From here you must install a compact application call up Mplayer, this will give your Wii to behave like a regular DVD gamer. The last action is to get a Dvdx loader method which helps the playback of Dvd and blu-ray.&lt;br /&gt;
&lt;br /&gt;
The whole procedure from start to finish can take fewer than 15 minutes for those who have all the correct programs practical and it in fact is pretty self-explanatory and that is how to play Video on the Nintendo wii.&lt;br /&gt;
&lt;br /&gt;
Another great factor about having the power to play Disc on your Wii is that whenever you install the software it helps you play your own personal homebrew games, this includes activities that work around the N64 and even the actual NES models and if you are truly tech savvy you can even compose your own programs to run within the Wii.&lt;br /&gt;
&lt;br /&gt;
If you would like to learn in depth how to engage in Wii Home brew Games then come and also visit our site to also learn to play Dvd on Wii.&lt;br /&gt;
&lt;br /&gt;
[http://www.prlog.org/10788492-play-movies-on-wii-learn-how-to-play-movies-on-wii.html http://www.prlog.org/10788492-play-movies-on-wii-learn-how-to-play-movies-on-wii.html]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/FL-6roY4faRn2BNddO9PRSNKxJk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/FL-6roY4faRn2BNddO9PRSNKxJk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/FL-6roY4faRn2BNddO9PRSNKxJk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/FL-6roY4faRn2BNddO9PRSNKxJk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/2x91GaN1is8" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 16:48:30 GMT</pubDate>			<dc:creator>JennMars406</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:JennMars406</comments>		</item>
		<item>
			<title>MonikaMaze775</title>
			<link>http://en.wikipilipinas.org/index.php?title=MonikaMaze775</link>
			<description>&lt;p&gt;Summary: New page: ==The Rainforests Is The Way To Your Life:Protect Them==  If you are prepared to uncover more '''[&amp;lt;&amp;lt;http://www.cuipo.org/Discover/TheRainforest/AbouttheRainforest&amp;gt;&amp;gt; about rainforest]''', f...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==The Rainforests Is The Way To Your Life:Protect Them== &lt;br /&gt;
If you are prepared to uncover more '''[&amp;lt;&amp;lt;http://www.cuipo.org/Discover/TheRainforest/AbouttheRainforest&amp;gt;&amp;gt; about rainforest]''', firstly that you need to know is the fact that rainforest covers only 6% of the surface on this planet. Still, it houses over half of the world’s animal and plant species in comparison to the other biological communities all over the world. Hence, a rainforest is nothing but a tall and highly dense jungle that receives high amount of rainfall every year. This is how rainforest has been named. &lt;br /&gt;
&lt;br /&gt;
About rainforest, an extra important point that you got to know is that they have four layers to them. The Emergent Layer includes the tallest trees that happen to be 200 feet over the floor from the forest. Next is the Canopy Layer which is the principal layer of the forest and is often accepted as the rooftop for the two layers- Understory Layer and the Forest Floor. The Understory Layer includes plants that do not grow more than 12 feet and houses animals and insects. However, the Forest Floor is quite dark due to the insufficient sun light that hardly reaches the layer. &lt;br /&gt;
&lt;br /&gt;
Generally, the climate of a typical rainforest is humid and hot. Its considered that there is some 3000 plants housed in the rainforest with anti-cancer chemical products. A lot of other pharmaceutical prescription medication is also developed through the plants of rainforest. Moreover, it is the recycling center on earth for oxygen production also and it is transforming the co2 produced on the planet into oxygen continuously. In the midst, among the extremely saddening facts about rainforest is it is being destroyed, at a truly alarming rate of greater than 108,000 acres being lost almost on a regular basis.&lt;br /&gt;
&lt;br /&gt;
One of many highly popular rainforest across the world would be the '''[&amp;lt;&amp;lt;http://www.cuipo.org&amp;gt;&amp;gt; Amazon rainforest]''' that covers the basin of the world’s second longest river, Amazon. The Amazon rainforest is a home to an array of animals and plants of the planet. Approximately 1/10th of mammal species and 1/5th of birds and plant species are housed in this rainforest. Most importantly, the Amazon rainforest is referred to as the Earth’s lungs because of it produces a lot more than 20%of Earth’s oxygen which is considerably more than any single source, hence, the key supply of air which we breathe.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/kobxiHcwpxkLvpchMve6I-qmLys/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/kobxiHcwpxkLvpchMve6I-qmLys/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/kobxiHcwpxkLvpchMve6I-qmLys/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/kobxiHcwpxkLvpchMve6I-qmLys/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/UOoQ2RbZTPA" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 12:39:22 GMT</pubDate>			<dc:creator>MonikaMaze775</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:MonikaMaze775</comments>		</item>
		<item>
			<title>ZAHARIQUINTIN368</title>
			<link>http://en.wikipilipinas.org/index.php?title=ZAHARIQUINTIN368</link>
			<description>&lt;p&gt;Summary: New page: Know all about Book Keeping  Book keeping is generally one of the best and well known key elements to consider if you are running your own company. This not only generates end of the year ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Know all about Book Keeping&lt;br /&gt;
&lt;br /&gt;
Book keeping is generally one of the best and well known key elements to consider if you are running your own company. This not only generates end of the year records, which are appropriate for the precise perform for the peoples added to the factor for any online company, which helps you in keeping ascendancy on quantity and for that know-how aerate the income as well. Recent internet surveys have recommended that about 50% of the few corporations in England were unable to provide the details of their end year records to their agency. Reliability is informed along with that account, as a result of which the end of the year records into their agency were quickly determined. This passion of commonly aftereffects behind acquiescence for the Revenue so back an aftereffect the small gathering or amassing to the client will be fined. It is approximated that with 2008 in terms of article like 30% associated with small corporations in the UK will follow furthermore on that factor who are currently following tax claims. &lt;br /&gt;
 &lt;br /&gt;
You can still purchase the small corporations who never did book keeping until now, which can be perfectly intensive. Other peoples acquire their own book keeping for you to apply these on operating their company day to day eventually.  The key know-how for book keeping sales application is that you can advance the procedure. It helps you in making or arranging your records within hours. The best valuable allowance of these types of wills is the potential as able person as records which they create. In a stream you will get income that your visitors accept them around just about every achieved debt or like surpassed their popularity score. Your own advertising of providers as buying any aberrant records determine VAT for you personally for Stock ascendancy and like position you are more versatile in earning more money. With these precise potential small company entrepreneurs will achieve people's primary choices in respect to their own company, wedding, birthday or as well every day, after a cat-and-mouse for their precise yearly or 50 percent yearly records. To achieve a recognized company is to obtain anchored ascendancy on your quantity and benefiting in dual income and to power the advice at fight it out is critical. Book keeping abstracts handling application materials are primarily equipment by having a helping company. &lt;br /&gt;
 &lt;br /&gt;
If you are running an online company, then you do not need to appear out and get the antecedent combination union. It is absolutely a capital to be abiding. It will provide you with the appropriate factors you charge to process financial provide for your company. One of the best and reliable books keeping records program triggered is academician records. It is an absolute combination and will provide all factors that are required by you. Although it may be an accessible to use like other applications there are the best and furthermore incorrect means to use that. Having a book keeping range like academician records may be in terms of cogent advantage to be all a small gathering or amassing in handling a non appropriate now. Presently new accuracy is informed along with that record, so actual financial bearings and furthermore optimizing the companies are much easier.&lt;br /&gt;
&lt;br /&gt;
[http://www.katalog-uctovnikov.sk/ Click Here] to know more about účtovníctvo.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/1RRs5_65udoZuN_nfALxA_c7iLo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1RRs5_65udoZuN_nfALxA_c7iLo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/1RRs5_65udoZuN_nfALxA_c7iLo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1RRs5_65udoZuN_nfALxA_c7iLo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/UrsEs-BLB2k" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 11:31:57 GMT</pubDate>			<dc:creator>ZAHARIQUINTIN368</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ZAHARIQUINTIN368</comments>		</item>
		<item>
			<title>Cheap snapbacks 2755</title>
			<link>http://en.wikipilipinas.org/index.php?title=Cheap_snapbacks_2755</link>
			<description>&lt;p&gt;Summary: New page: Fitted [http://myon.me/making-a-statement-with-new-era-hats/ vintage snapback hat] are well shaped to match exactly on the mind of the consumer. These lids are receiving popular and fashio...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Fitted [http://myon.me/making-a-statement-with-new-era-hats/ vintage snapback hat] are well shaped to match exactly on the mind of the consumer. These lids are receiving popular and fashionable everyday. When equipped hats hold the company logo or occasion, then they becomes a type of billboard and the workers and the consumers who wear them become walking advertisements for the companys personality. Theyre ideal gifts for corporate parties and to build brand awareness.These caps use various kinds of clothes such as pure cotton, natural wool, wool and fat, applied fat, and canvas and cotton. These installed [http://www.oecd-antispam.org/shopping/snapback-hats-of-today.html cheap snapback] usually use merely a emblem embroidered on the hat. The embroidered brand could possibly be on the top, right aspect, left side, back, or all over. Craft and design solutions of the hat manufacturer assist in brand designing and the place of logo on the cap. To create an embroidered fitted [http://www.jolcdi.com/2012/05/04/why-choose-mitchell-and-ness-snapback-hats/ mitchell and ness snapback hat], producers use different processes to fit the cap particularly on the mind. With this, they use a hook-and-loop fastener and an adjustable strip back closing additionally they make caps in universal shapes. Additionally they make small and large hats for various head sizes. Some hat manufacturers provide a conversion graph for fitted cap shapes. They make exactly fixed hats.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/VDFJbhMcRFJtzbkuS2p7zaxEZ8w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/VDFJbhMcRFJtzbkuS2p7zaxEZ8w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/VDFJbhMcRFJtzbkuS2p7zaxEZ8w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/VDFJbhMcRFJtzbkuS2p7zaxEZ8w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/xflZOV_yp9Q" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 11:02:21 GMT</pubDate>			<dc:creator>Cerma48</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Cheap_snapbacks_2755</comments>		</item>
		<item>
			<title>Why start a home Internet business.</title>
			<link>http://en.wikipilipinas.org/index.php?title=Why_start_a_home_Internet_business.</link>
			<description>&lt;p&gt;Summary: Why start a home Internet business.&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Why start a MLM business.&lt;br /&gt;
&lt;br /&gt;
Seven years ago I decided to start a online Internet based business. Since then, I couldn't imagine doing anything else. &lt;br /&gt;
&lt;br /&gt;
Working 9 to 5, Six days per week just doesn't look like a lot of fun to me. There must be more to life than working it away. &lt;br /&gt;
&lt;br /&gt;
It still baffles me how many people will work for 40 years, only to retire on a minimum wage. Surely it is much much easier to start an online home business and escape the rat race forever. &lt;br /&gt;
&lt;br /&gt;
It can also be something both you and your partner could do with each other. No more waking up to the damn alarm clock!&lt;br /&gt;
&lt;br /&gt;
How do you search for a good Home based business? I am glad you asked. &lt;br /&gt;
&lt;br /&gt;
The best way to do it is follow someone that has done it successfully before you. All you have to do is duplicate what they have done, and you should experience the same type of success.&lt;br /&gt;
&lt;br /&gt;
Make sure it has a proven system. This way you can use the same system, and so can the people you bring into the opportunity. This will ensure your long term success. &lt;br /&gt;
&lt;br /&gt;
Also, you must have a passion for the product or service you are providing. It is no good promoting a product you either don't believe in or don't use at all yourself. &lt;br /&gt;
&lt;br /&gt;
If you truly want to escape the painful 40 year, 6 days per week plan, I urge you to get involved in a online business straight away. &lt;br /&gt;
&lt;br /&gt;
You will never look back. This I will promise you.&lt;br /&gt;
&lt;br /&gt;
For more information check out my Blog [http://www.michaelharringtonblog.com make money online]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/8pg76jySe4_tKrfUDce_N7DYhUs/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8pg76jySe4_tKrfUDce_N7DYhUs/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/8pg76jySe4_tKrfUDce_N7DYhUs/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8pg76jySe4_tKrfUDce_N7DYhUs/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/_DUTjKG1fMM" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 10:33:47 GMT</pubDate>			<dc:creator>Alberto92gfr2</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Why_start_a_home_Internet_business.</comments>		</item>
		<item>
			<title>Meboyunlari</title>
			<link>http://en.wikipilipinas.org/index.php?title=Meboyunlari</link>
			<description>&lt;p&gt;Summary: New page: [http://www.oyunde.com/oyun_oynak/meboyunlari Meb oyunları]nı seven biriyseni oyunde.com üzerindeki meb oyunları tam size göre çünkü sizin için en yeni meb oyunlarını tek pakett...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[http://www.oyunde.com/oyun_oynak/meboyunlari Meb oyunları]nı seven biriyseni oyunde.com üzerindeki meb oyunları tam size göre çünkü sizin için en yeni meb oyunlarını tek pakette topluyoruz sizin yapmanız gereken tek şey [http://www.oyunde.com/oyun_oynak/meboyunlari Meb oyunları] kategorisinden oyununuzu seçmek ve meb oyununuzu oynamaya başlamak hepsi bu kadar&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/mIgSyBtgBHVR2Fez4jzAe3BrVMM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/mIgSyBtgBHVR2Fez4jzAe3BrVMM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/mIgSyBtgBHVR2Fez4jzAe3BrVMM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/mIgSyBtgBHVR2Fez4jzAe3BrVMM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/b7CV2IBMbPM" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 10:23:10 GMT</pubDate>			<dc:creator>Meboyunlari</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Meboyunlari</comments>		</item>
		<item>
			<title>Where you can Come across Inexpensive Quality Body Parts In your Car Or Truck</title>
			<link>http://en.wikipilipinas.org/index.php?title=Where_you_can_Come_across_Inexpensive_Quality_Body_Parts_In_your_Car_Or_Truck</link>
			<description>&lt;p&gt;Summary: New page: The small business of automotive sections is probably the most versatile areas you can find while in the market today. For skilled automobile specialists, discovering superior auto pieces ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The small business of automotive sections is probably the most versatile areas you can find while in the market today. For skilled automobile specialists, discovering superior auto pieces which will go well with their wants is but so simple as going into a shop specializing in auto elements and getting a large array of gizmos and gadgets. The excellent news about these gizmos and gizmos is it's possible to always obtain them in many kinds and price ranges. This implies that when you are on a spending budget and would love to avoid wasting on price but nonetheless would love to get top quality automotive spare elements, you could generally find the kinds you'll need in a single of those people retailers specializing in them. Since you can quickly discover numerous very good automotive parts suppliers throughout the country, it's going to be simpler in your case to compare the costs plus the superior from the sections they've on their shelves.&lt;br /&gt;
&lt;br /&gt;
For individuals who will be nonetheless new to your automotive spare sections business, you will discover some elements you must know to be able suitable for you to get the very best specials you can find over the current market. Initially, it is best to constantly bear it in head that if you repair service engines, there are actually spare sections that you can salvage and may however use. Of course you will find some elements, which can be actually ineffective, but there are numerous other things you can preserve for later use.&lt;br /&gt;
&lt;br /&gt;
Now, the next thing that you must bear in mind is the fact different road problems may have distinctive effects on automobiles. By way of example, the utilization of salt within the roads in Detroit to boost traction has detrimental effects on the automobile. Salt can cause corrosion over the car consequently in these places, acquiring made use of spare parts which might be however in great issue might be hard. On the other hand, in locations like California exactly where road problems are alternatively very good, acquiring used spare pieces which have been nevertheless in fantastic condition wouldn't be considerably of a difficulty.&lt;br /&gt;
&lt;br /&gt;
Now, never believe that finding great utilized automobile elements is just like a stroll in park because it's not. Similar to other businesses, buying made use of spare parts will involve lots of kinks and tricks. When you really need to get both hands on great, applied automotive parts, you might want to go the suppliers advertising junk and simply go for the gold. Whenever we say go to the gold, try to acquire salvage title automobiles and choose it aside. There are many firms selling most of these products and you can even invest in these salvage cars and trucks for the fraction in their expense. These salvage autos are truly a gold mine with regards to getting fantastic utilised automotive spare sections. Since is real value in your income!&lt;br /&gt;
&lt;br /&gt;
Do you need more info about [http://www.beautypower.co.id/ Bengkel Mobil Jakarta] , check out my website immediately to learn more information here [http://www.beautypower.co.id/auto-parts spare part mobil] and [http://www.beautypower.co.id/service bengkel modifikasi mobil]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/5q2zjtDjgJ_48oZBd7LNqt3u6y0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/5q2zjtDjgJ_48oZBd7LNqt3u6y0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/5q2zjtDjgJ_48oZBd7LNqt3u6y0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/5q2zjtDjgJ_48oZBd7LNqt3u6y0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/jZj8ME834Ok" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 09:54:57 GMT</pubDate>			<dc:creator>Where you can Come across Inexpensive Quality Body Parts In your Car Or Truck</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Where_you_can_Come_across_Inexpensive_Quality_Body_Parts_In_your_Car_Or_Truck</comments>		</item>
		<item>
			<title>RegineLotz976</title>
			<link>http://en.wikipilipinas.org/index.php?title=RegineLotz976</link>
			<description>&lt;p&gt;Summary: New page: Most effective Value Monroe Shock Absorbers and Struts [http://www.shockmonroe.com/ Monroe] Shock Absorbers and Struts are made of leading top quality and solid supplies. They are identifi...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Most effective Value Monroe Shock Absorbers and Struts&lt;br /&gt;
[http://www.shockmonroe.com/ Monroe] Shock Absorbers and Struts are made of leading top quality and solid supplies. They are identified for their item superior, strength, long product durability, smooth reaction and reliability.&lt;br /&gt;
&lt;br /&gt;
Making use of Monroe shocks and struts, you may feel your car or truck a minimum of half lighter. You'll possess a wonderful and smooth ride. Your auto drives like brand new. You might be not merely saving alot on power and petrol, ultimately you're saving more income and stretching your pockets.&lt;br /&gt;
&lt;br /&gt;
[http://www.shockmonroe.com/ Monroe Shocks]  and struts are simple to install and ensured fuss no cost! Most effective factor is, self installation could conserve you 5 instances the cost of replacement.&lt;br /&gt;
&lt;br /&gt;
Numerous prospects are very happy and really happy purchasing Monroe shocks and struts. Read ShockMonroe on the net for their their star ratings and discover out their critiques and thoughts about their purchases and experiences.&lt;br /&gt;
&lt;br /&gt;
Acquiring on-line is so hassle-free. You do not need to get out from your home. Your shocks and struts might be delivered to you within a jiffy. Most importantly you get to conserve much more time and a lot more revenue.&lt;br /&gt;
&lt;br /&gt;
You can search on line go via websites by internet sites to look for the value and package you might be pleased with. &lt;br /&gt;
Alternatively if you'd like get to acquire the very best provide with quality service and free fast delivery, do take a look at [http://www.shockmonroe.com/ Monroe Shock absorber].&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/HpNX4DVfzBzRH0axUDYyJuGWvEQ/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HpNX4DVfzBzRH0axUDYyJuGWvEQ/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/HpNX4DVfzBzRH0axUDYyJuGWvEQ/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HpNX4DVfzBzRH0axUDYyJuGWvEQ/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/Q1wzIE4JEPI" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 09:23:34 GMT</pubDate>			<dc:creator>RegineLotz976</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:RegineLotz976</comments>		</item>
		<item>
			<title>BuntingLamm2</title>
			<link>http://en.wikipilipinas.org/index.php?title=BuntingLamm2</link>
			<description>&lt;p&gt;Summary: New page: You hear so much regarding [http://creditagenda.com/affiliate.php Credit Repair Affiliate] that when your plagued with difficulty credit  it really is tempting to acquire their enable to d...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;You hear so much regarding [http://creditagenda.com/affiliate.php Credit Repair Affiliate] that when your plagued with difficulty credit  it really is tempting to acquire their enable to deal with your poor credit. Nevertheless,generating an excellent alternative may possibly not be so straightforward, due to the fact you'll find that evaluating such providers in not such an easy process! Because they are service oriented, there's little to check physically, and deciding on by trial and error is ... properly, a really poor concept!&lt;br /&gt;
&lt;br /&gt;
Listed here are three points which you need to appear into ahead of you make up your thoughts. These indicators may also stop you from getting taken benefit of by much less than reputable corporations that aim only at utilizing your desperation to fleece you of the dollars.&lt;br /&gt;
&lt;br /&gt;
1. Honest Businesses Are Affiliated With Organizations&lt;br /&gt;
&lt;br /&gt;
As with any very good organization, an expert agency will affiliate itself with reputable regulatory bodies just like the BBB (Improved Business enterprise Bureau) or the ECRA (Ethical Credit Repair Alliance). The affiliation would have these providers abide by specific company codes, that offers protection to you the consumer.&lt;br /&gt;
&lt;br /&gt;
Verify out no matter whether the business you will be organizing to pick out has any affiliations. What are they? Do not cease at obtaining out what affiliations they've - study a little further and check whether or not these regulatory bodies are indeed what they claim to become. Analysis on the Net and get the full picture.&lt;br /&gt;
&lt;br /&gt;
two. Trustworthy Companies Have Happy Clientele [http://creditagenda.com/affiliate.php Credit Repair Affiliate Program] It really is always expected that a superb neighborhood agency would have a fair quantity of verbal positive feedback from local men and women. This is a superb sign that this company delivers on its promises. Nevertheless, do not make a decision just on the basis of hearsay.&lt;br /&gt;
&lt;br /&gt;
Ask them to offer you the name of a handful of customers who they worked with satisfactorily and after that spend them a stop by. Most people would really like to cooperate and advise the corporation if they had been pleased with their services. Ask them concerning the services they give, the procedures they utilised to enhanced poor credit along with the charges they charged.&lt;br /&gt;
&lt;br /&gt;
three. Respected Credit Repair Organizations Do not Sell You Shortcuts&lt;br /&gt;
&lt;br /&gt;
Within this organization shortcuts don't exist. Your credit score will not be going to improve overnight, nor are you able to make your bad credit disappear.&lt;br /&gt;
&lt;br /&gt;
Be wary about  credit repair businesses that promise immediate results. It's likely that they are lying or that they may be making use of illegal means. Usually do not walk into such a trap simply because this could end incredibly ugly for you. Stick to legitimate methods to enhance your credit rating and within the finish you are going to be the winner.&lt;br /&gt;
&lt;br /&gt;
As you can see, it really is achievable to make an excellent choice from amongst the many providers that you discover on and off the Net. Just keep in mind that it is much better to become slow but thorough inside the starting, than to act rashly after which regret it later [http://creditagenda.com/affiliate.php Credit Repair Services Affiliate Program] .&lt;br /&gt;
&lt;br /&gt;
Jim Eastman writes on organization associated topics and is often a robust advocate of marketing organization ethics, particularly within the credit repair sector.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Psa3ZoLejlpkaMK8D1zxXn8ranI/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Psa3ZoLejlpkaMK8D1zxXn8ranI/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Psa3ZoLejlpkaMK8D1zxXn8ranI/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Psa3ZoLejlpkaMK8D1zxXn8ranI/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/tpHXW8LCN6A" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 09:19:28 GMT</pubDate>			<dc:creator>BuntingLamm2</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:BuntingLamm2</comments>		</item>
		<item>
			<title>VANCESABRA161</title>
			<link>http://en.wikipilipinas.org/index.php?title=VANCESABRA161</link>
			<description>&lt;p&gt;Summary: New page: Do you dredge up those years back in the ahead of schedule part of the decade?  Yes, those are the ones.  We all felt so a good deal better of in that case and seemed to comprise a few bob...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Do you dredge up those years back in the ahead of schedule part of the decade?  Yes, those are the ones.  We all felt so a good deal better of in that case and seemed to comprise a few bob get by without here and in attendance for mainly things. Co-incidentally, this is and when the leisure activity in cash off coupons especially took storeroom of the state and parents ongoing keeping all those vouchers, coupons and newspaper cut-outs with the purpose of promised a saving at this point and a discount there.&lt;br /&gt;
&lt;br /&gt;
Since time became harder it unaffectedly followed that pastime in concession coupons in universal and victuals stores in particular, got a kick start.&lt;br /&gt;
&lt;br /&gt;
So with advantage running at fever pitch again, we’re faced in the midst of a entirety new obliging trolley of offers and promises of monster discounts…monster discounts with the intention of is if we solitary sign up for this, with the intention of and the other.&lt;br /&gt;
&lt;br /&gt;
The formerly approach to engage is to go owing to reputable UK sites advertising coupons for supermarkets and or supermarket goods. The problem now is with the intention of many sites willpower pop up amid various slip offers and not all of them are reputable. You strength of character need to carrying out a insignificant due attentiveness to land at those with the purpose of are careful to be a large amount reliable.  a number of of these can be set up in this site’s blogroll on the left-hand bar if you ought a plateful hand to get started. period looking at these sites for ticket offers it’s too advisable to do a swift search of the position overall by putting it’s nickname into a hunt engine comparable Google.  A few transcription spent at this time will bowl up opinion-based in rank on a given position – as well as complaints.  near is often too an option at this time to poster up for a weekly newsletter so as to carry’s bang up-to-date in sequence on coupons so as to are presented by kind across supermarket stores.So you get the picture!. obstruction is, how do we make out which stores bargain the top free discounts and schemes. wherever can we get coupons separately from the stores themselves?  Which newspapers and magazines impart a full hunting knock down for us to explore?&lt;br /&gt;
&lt;br /&gt;
A second tactic is to holiday at the website of a number of UK supermarkets. at this time you desire normally attain those up to date coupons applicable to with the intention of store. Again, in a quantity of cases you may be bright to poster up to a newsletter/email which desire advise you of anticipated new offers more than coming weeks.&lt;br /&gt;
&lt;br /&gt;
Thirdly, it’s forever worth glance the newspapers and weekend magazines for special slip offers. The Sunday shocking magazines are until the end of time good and now you can find a choice of coupon offers. You strength of character want to ensure them weekly, however, as the exact kind of voucher you are following won’t be here every week.&lt;br /&gt;
&lt;br /&gt;
Finally, you strength of character now stumble on a few specialised slip sites now in the UK.  These give birth to been dull in the U.S. for a little time now and are at keep on starting to appear transversely the pond.  Again, a Google search willpower throw up more than a few options on this face and it is importance taking the schedule to stumble on out which are the on the whole up-to-date and present the main array of coupons for the Supermarket(s) of your choice.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/leig7z2PIL2ZgAyG3iqvHwf52ks/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/leig7z2PIL2ZgAyG3iqvHwf52ks/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/leig7z2PIL2ZgAyG3iqvHwf52ks/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/leig7z2PIL2ZgAyG3iqvHwf52ks/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/GlohF0V3l4M" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 24 May 2012 09:05:10 GMT</pubDate>			<dc:creator>VANCESABRA161</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:VANCESABRA161</comments>		</item>
		<item>
			<title>Independent Living Learning Centre</title>
			<link>http://en.wikipilipinas.org/index.php?title=Independent_Living_Learning_Centre</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''Independent Living Learning Centre''' (ILLC) is an institution which caters to the needs of childrens, adolescents and young adults with developmental conditions. It was established in July 2003 by Professor Archie David, an occupational therapy expert on transition programs. He is currently the ILLC's executive director. &lt;br /&gt;
&lt;br /&gt;
ILLC's aim is to improve the students' level of independence and quality of life. Such could be done by allowing them to be self-sufficient in areas of self-care, education, social interaction, work and recreation. To help generalize learning, practical learning activities for independent living are provided both in home and community settings. &lt;br /&gt;
&lt;br /&gt;
With the help of more than fifteen licensed occupational, physical and speech therapists, the school offers early intervention occupational, physical and speech therapies to enhance the psychosocial, speech and language, cognitive, fine and gross motor skills of its students. Peer group sessions are also being conducted to establish support systems and foster social interaction among youth with special needs. [[Special education]] (SPED) tutorials and classes are also being offered.&lt;br /&gt;
&lt;br /&gt;
Other than academic and non-academic offerings, ILLC provides students with educational trips, sports tournaments and outreach activities through the Rehabilitation and Empowerment of Adults and Children with Handicap (REACH) Foundation. ILLC also has a cafe and laundromat in the area where students are given the opportunity to work as part of the program. They are compensated for their work and are given a regular paycheck.&lt;br /&gt;
&lt;br /&gt;
ILLC also develops and offers home programs for special learners residing in far areas.&lt;br /&gt;
&lt;br /&gt;
ILLC's main center is located at 575 Wack-wack Road, [[Mandaluyong City]]. It also has regional centers in [[Cebu]] and [[Dipolog]].&lt;br /&gt;
&lt;br /&gt;
==Mission and Vision==&lt;br /&gt;
The ILLC aims to actively participate in empowering more individuals with special needs to become happy, integrated and productive members of the society. &lt;br /&gt;
&lt;br /&gt;
Furthermore, it envisions itself to be the country's leading and self-sustaining hub for people with special needs. Its programs, amenities, and service will make it an important resource for [[Filipino|Filipinos]].&lt;br /&gt;
&lt;br /&gt;
==Program and services==&lt;br /&gt;
ILLC's services focus on enhancing skills in different areas of development. These services include:&lt;br /&gt;
*Speech and language&lt;br /&gt;
#Pre-speech training&lt;br /&gt;
#Language and congnitive stimulation&lt;br /&gt;
#Articulation, voice and fluency training&lt;br /&gt;
#Alternative communication training&lt;br /&gt;
*Pyscho-social&lt;br /&gt;
#Behavior modification program&lt;br /&gt;
#Social skills training&lt;br /&gt;
*Sensory-perceptual&lt;br /&gt;
#Sensory integration program&lt;br /&gt;
#Perceptual skills training&lt;br /&gt;
*Oral-motor feeding&lt;br /&gt;
#Oral-motor training&lt;br /&gt;
#Dysphagia (difficulty in swallowing) management&lt;br /&gt;
*Pre-speech training&lt;br /&gt;
#Language and cognitive stimulation&lt;br /&gt;
#Articulation, voice and fluency training&lt;br /&gt;
*Adaptive behavior&lt;br /&gt;
#Activities of daily living (ADL) training, pre-vocational training&lt;br /&gt;
#Skills training and play therapy&lt;br /&gt;
*Gross motor skills, posture, endurance and fitness&lt;br /&gt;
#Gross motor skills training&lt;br /&gt;
#Advanced motor skills training&lt;br /&gt;
#Neurodevelopmental skills training&lt;br /&gt;
#Seating device design and fabrication&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.illcphilippines.com/ “Welcome to ILLC”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.illcphilippines.com/3a_ps.html “Program and Services”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://philippines.panpages.com/listings/ph37042 “Independent Living Learning Center”].''Panpages''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=469729&amp;amp;publicationSubCategoryId=442 “ILLC: Enabling special children to be extraordinary”].''philSTAR.com''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://specialeducatorinmanila.blogspot.com/2012/03/independent-living-learning-centre-illc.html “Independent Living Learning Centre (ILLC)”].''Special educator in Manila''.(Accessed on 23 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://www.illcphilippines.com/5map.html “ILLC Map”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.autismpinoy.com/doctors-and-schools/sped-schools.html “SPED schools”].''Welcome to Autism Pinoy''.(Accessed on 23 May 2012)&lt;br /&gt;
*Rivadelo, Genevieve.[http://www.mb.com.ph/node/327296/wanted-a- “Wanted: A school for kids with mild mental retardation”].''mb.com.ph''.(Accessed on 23 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category:Special Education Schools in the Philippines]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/VvqLdjVK_Ds" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 23 May 2012 09:29:28 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Independent_Living_Learning_Centre</comments>		</item>
		<item>
			<title>Norman Gonzales</title>
			<link>http://en.wikipilipinas.org/index.php?title=Norman_Gonzales</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox NBA Player&lt;br /&gt;
|name =  Norman Gonzales&lt;br /&gt;
|nickname = &lt;br /&gt;
| image = &lt;br /&gt;
|league =  Asean Basketball League&lt;br /&gt;
|height_ft = 6 | height_in = 4 | weight_lbs=200&lt;br /&gt;
|team = [[San Miguel Beermen]]&lt;br /&gt;
|position = Small forward/Power forward&lt;br /&gt;
|birth_date =  21 May 1976&lt;br /&gt;
|birth_place = [[Pampanga]]&lt;br /&gt;
|death_date = &lt;br /&gt;
|death_place = &lt;br /&gt;
|college = [[San Beda College]]&lt;br /&gt;
|nationality = Filipino&lt;br /&gt;
|draft = 7&amp;lt;sup&amp;gt;rd&amp;lt;/sup&amp;gt; overall&lt;br /&gt;
|draft_team =  Mobiline Phone Pals&lt;br /&gt;
|draft_year = 2011&lt;br /&gt;
|former_teams = Powerade Tigers (2009-11) &amp;lt;br&amp;gt; [[Sta.Lucia Realtors]] (2004-2009) &amp;lt;br&amp;gt; [[Talk 'N Text Phone Pals]] (2001-2003) &lt;br /&gt;
|career_start = &lt;br /&gt;
|career_end =&lt;br /&gt;
|awards =&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Norman Gonzales''' (born 21 May 1976 in [[Pampanga]]) is a [[Filipino]] professional basketball player. He currently plays for the San Miguel Beermen in the Asean Basketball League (ABL). He was drafted the seventh overall in 2011 by the Mobiline Phone Pals.&lt;br /&gt;
&lt;br /&gt;
==Player profile==&lt;br /&gt;
Gonzales, with basketball jersey no. 28, began his basketball career for playing as a small forward or power forward for the [[San Beda College]].&lt;br /&gt;
&lt;br /&gt;
After entering ABL in 2001, he became its toughest sixth man. He was known for giving big points to the team. He produced double points in his amateur days playing in the now defunct MBA. &lt;br /&gt;
&lt;br /&gt;
Gonzales was also known as a good defensive stopper inside and outside. He spent two years playing for [[Talk 'N Text Phone Pals|Talk 'N Text]] before signing up as a free agent of [[Sta.Lucia Realtors|Sta. Lucia]].&lt;br /&gt;
&lt;br /&gt;
He was also signed as a free agent of [[Coca-Cola Tigers]], where he became one of their reliable role players, in August 2009.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.pba-online.net/profile/Norman-Gonzales/99/ “Norman Gonzales”].''PBA Online!''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://www.enotes.com/topic/Norman_Gonzales “Norman Gonzales”].''eNotes''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://www.aseanbasketballleague.com/stats/player/118 “Norman Gonzales”].''Air Asia ASEAN Basketball League''.(Accessed on 21 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://www.pba.ph/news/entry/1115 “Powerade Acquires More Fresh Talents”].''PBA News''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://twitter.com/#!/normG28 “Norman Gonzales on Twitter”].''twitter''.(Accessed on 21 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Philippines-stub}}&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category:Filipino Professional Basketball Players]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/UGPH9369aW4" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 21 May 2012 09:36:26 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Norman_Gonzales</comments>		</item>
		<item>
			<title>International Museum Day</title>
			<link>http://en.wikipilipinas.org/index.php?title=International_Museum_Day</link>
			<description>&lt;p&gt;Summary: New page: The '''International Museum Day''' is a yearly event aimed to raise awareness on how important museums are in the development of the society.  Since 1977, the International Museum Day is o...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''International Museum Day''' is a yearly event aimed to raise awareness on how important museums are in the development of the society.&lt;br /&gt;
&lt;br /&gt;
Since 1977, the International Museum Day is organized worldwide. The International Council of Museums (ICOM) Advisory Committee organizes the theme of the event. Participating countries ranges from America to Oceania including Africa, Europe and [[Asia]]. The event has been experiencing [http://icom.museum/what-we-do/activities/international-museum-day.html its highest involution with almost 30,000 museums that organised activities in more than 100 countries.] Event activities include talks from scientists, workshops and tours. &lt;br /&gt;
&lt;br /&gt;
IMD 2012 marks its 35th anniversary. With the theme “Museums in a Changing World. New Challenges, New Inspirations,” &amp;quot;IMD2012 is as much about museums growing and shaping their future, as it is about displaying and interpreting new issues like climate change, new media or social responsibility,&amp;quot; says ICOM on its official website.&lt;br /&gt;
&lt;br /&gt;
==2012 International Museum Day in the Philippines==&lt;br /&gt;
*The [[Ayala Museum]] in [[Makati]] offers free admission on May 18 in celebration of the event.&lt;br /&gt;
*The [[Mind Museum]] in [[Taguig]] offers a discounted rate of P500 for all-day passes. &lt;br /&gt;
*The [[Philippine Science Centrum]] in [[Marikina]] offers free admission for the first 200 visitors and  a P60 entrance (50% discount of the P120 original entrance pass) for the whole month.&lt;br /&gt;
*In [[Tuguegarao City]], museum workers will conduct a seminar and education tour at the Lyceum of Aparri Museum, Heritage Churches of [[Cagayan]], Piat Basilica Minore including the [[Cagayan]] Museum, and the [[Callao Caves]] Tourist Zone.&lt;br /&gt;
*The Kuliat Foundation Inc. of [[Tarlac City]] will host museum visits and lectures on &amp;quot;The Role of Museums in a New Society, Using the Past to Build the Future, New Media and Innovation.&amp;quot;&lt;br /&gt;
* With the theme “Gabii sa Kabilin,” [[Cebu City]] museums and heritage sites will open from 6 p.m. until midnight.&lt;br /&gt;
*An exhibit of World War II memorabilia collections will be held at the CNU Museum in [[Cebu]].&lt;br /&gt;
*A cooking demonstration of native delicacies of [[Mandaue]] will be held at the [[Mandaue City]] Central Plaza.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://icom.museum/what-we-do/activities/international-museum-day.html “International Museum Day”].''The World Museum Community''.(Accessed on 18 May 2012)&lt;br /&gt;
*Lapeña, Carmela G.[http://www.gmanetwork.com/news/story/258602/lifestyle/culture/filipinos-celebrate-international-museum-day-on-may-18 “Filipinos celebrate International Museum Day on May 18”].''GMA News Online''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://www.huffingtonpost.com/2012/05/17/international-museum-day-_n_1524828.html “International Museum Day 2012: Celebrate International Museum Day At Our Local Museums”].''Huff Post Los Angeles''.(Accessed on 18 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External Links==&lt;br /&gt;
*[https://www.facebook.com/internationalmuseumday “International Museum Day- ICOM”].''facebook''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://www.boy-kuripot.com/2011/05/international-museum-day-11.html “International Museum Day '11”].''Philippine Freebies, Promos, Contests and More!''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://ph.news.yahoo.com/arts-agenda-international-museum-day-futureeverything-festival-art-200615323.html “Arts agenda: International Museum Day, FutureEverything Festival, Art HK”].''Yahoo! News''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://pinoyown.com/?p=64758  “Filipinos celebrate International Museum Day on May 18”].''newstheme''.(Accessed on 18 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category: Social Events]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/gwge9NbqlJo" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 18 May 2012 07:54:54 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:International_Museum_Day</comments>		</item>
		<item>
			<title>Jessica Sanchez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Jessica_Sanchez</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox musical artist &lt;br /&gt;
| Name                = Jessica Sanchez&lt;br /&gt;
| Img                   = Jessica.jpg&lt;br /&gt;
| Img_size           = 250px&lt;br /&gt;
| Background        = solo_singer&lt;br /&gt;
| Birth_name        =  &lt;br /&gt;
| Alias               = Jessica Sanchez&lt;br /&gt;
| Origin              = Chula Vista, California &lt;br /&gt;
| Born                = 4 August 1995&lt;br /&gt;
| Instrument          = Vocals&lt;br /&gt;
| Genre               = Hip Hop / R&amp;amp;B / Soul &lt;br /&gt;
| Occupation          = Singer&lt;br /&gt;
| Years_active        = 2006-present&lt;br /&gt;
| Label               = &lt;br /&gt;
| URL                 = [http://www.youtube.com/jsanchezfan  Official Jessica Sanchez on YouTube]&lt;br /&gt;
| notable role        = &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Jessica Sanchez''' (born 4 August 1995) is an American singer with Mexican and [[Filipino]] heritage. She is the runner-up of American Idol's (AI) eleventh season.&lt;br /&gt;
&lt;br /&gt;
==Early life==&lt;br /&gt;
Sanchez was born in Chula Vista, California. Her father Gilbert is from Mexico while her mother Editha is from [[Bataan]], [[Philippines]]. Because she was busy with music, she was homeschooled prior to trying out for AI. She took choir at Eastlake Middle School while in the eighth grade.&lt;br /&gt;
&lt;br /&gt;
==Rise to fame==&lt;br /&gt;
Sanchez has been singing since the age of 2 and sang in public by performing onstage on her 7th birthday. At the early age of 9, she earned two sit-down auditions with the A&amp;amp;R Department of Warner Bros. Records.&lt;br /&gt;
&lt;br /&gt;
She received her first standing ovation on television when she performed on the legendary music program ''Showtime at the Apollo'' when she was only 10 years old. Whoopi Goldberg, the Apollo host at the time, even called her back out on stage to accept a second round of applause.&lt;br /&gt;
&lt;br /&gt;
By age 11, the powerhouse singer amazed her audience by giving her own rendition of Celine Dion's “I Surrender” on ''America's Got Talent''. AGT judge and recording artist Brandy said, “You’re gonna be huge, I promise.” Simon Cowell, AGT producer and former AI judge, said that she was one of the best he's ever heard. Sanchez was eliminated in the semifinals.&lt;br /&gt;
&lt;br /&gt;
At age 13, Sanchez sang the American National Anthem before the Chargers' “Monday Night Football” game against the New York Jets in front of 68,922 people at Qualcomm Stadium. She admitted that she was nervous as it was her first time to sing in front of many people but she did a great job. She said that she hoped to get a record deal one day when asked on an interview after her performance. Her mother, who was in the audience at the time, said that she was very proud of Jessica. She was invited back in 2009 to sing the National Anthem when the Chargers fought the Miami Dolphins.&lt;br /&gt;
&lt;br /&gt;
She even had a stint in acting, when she starred in a nationally televised commercial campaign for Cricket Wireless. Producers said that they discovered her on YouTube. Her channel has already generated 22,000,000 views.&lt;br /&gt;
&lt;br /&gt;
Sanchez received her musical training as a scholar in the prestigious Theatre of Arts in Hollywood.&lt;br /&gt;
&lt;br /&gt;
==Awards and Recognition==&lt;br /&gt;
Sanchez has won many local singing competitions. In October 2009, She was selected by the Hepatitis B Foundation to participate in a three-city college campus music tour to help raise awareness about the medical condition.&lt;br /&gt;
&lt;br /&gt;
==''American Idol'' Overview==&lt;br /&gt;
Jessica auditioned for AI's eleventh season in her hometown of San Diego, California. Her group performance with Deandre Brackensick and Candice Glover of Buddy Holly's ''It Doesn't Matter Anymore'' received a standing ovation from AI's three judges.&lt;br /&gt;
&lt;br /&gt;
Sanchez has twice chosen Whitney Houston songs, a way too risky for any veteran AI contestant. She performed impressive renditions of “Bohemian Rhapsody” and Luther Vandross' “Dance With My Father”. AI judge Jennifer Lopez said that the latter was the most beautiful version she has ever heard. Steven Tyler even said &amp;quot;I don't think you could sing a song bad.&amp;quot; &lt;br /&gt;
&lt;br /&gt;
The judges chose to use their save on her when she landed on the bottom heap and faced elimination in the Top 7 week.  She is the first female finalist in AI history to receive the Judges' Save. &lt;br /&gt;
&lt;br /&gt;
As of April 2012, Sanchez already has 117,600 followers on Twitter. Even celebrities like AI finalists Adam Lambert and Jennifer Hudson, and TV talk show host Mario Lopez, a Chula Vista native, support her and hope she wins in the finals.&lt;br /&gt;
&lt;br /&gt;
Sanchez sang three songs in the semifinals: Mariah Carey’s “My All,” Aerosmith’s “I Don’t Wanna Miss A Thing,” and Jackson 5’s “I’ll Be There”. She was named one of the top two finalists. &lt;br /&gt;
&lt;br /&gt;
On 23 May 2012, Phillip Phillips bested Sanchez after a record-breaking total of 132 million votes. &lt;br /&gt;
&lt;br /&gt;
===Performances and results===&lt;br /&gt;
{|class=&amp;quot;wikitable&amp;quot; style=&amp;quot;text-align: center;&amp;quot;&lt;br /&gt;
!Episode&lt;br /&gt;
!Theme&lt;br /&gt;
!Song choice&lt;br /&gt;
!Original artist&lt;br /&gt;
!Order #&lt;br /&gt;
!Result&lt;br /&gt;
|-	&lt;br /&gt;
|Audition&lt;br /&gt;
|Auditioner's Choice&lt;br /&gt;
|&amp;quot;(You Make Me Feel Like) A Natural Woman&amp;quot;&lt;br /&gt;
|Aretha Franklin&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 1&lt;br /&gt;
|First Solo&lt;br /&gt;
|&amp;quot;Get Me Bodied&amp;quot;&lt;br /&gt;
|Beyoncé&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 2&lt;br /&gt;
|Group Performance&lt;br /&gt;
|colspan=2|Not aired&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 3&lt;br /&gt;
|Second Solo&lt;br /&gt;
|colspan=2|Not aired&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Las Vegas Round&lt;br /&gt;
|Songs from the Music history of the United States (1940s and 50s)&amp;lt;br /&amp;gt;Group Performance&lt;br /&gt;
|&amp;quot;It Doesn't Matter Anymore&amp;quot;&lt;br /&gt;
|Buddy Holly&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Final Judgment&lt;br /&gt;
|Final Solo &lt;br /&gt;
|&amp;quot;The Prayer'' (Celine Dion and Andrea Bocelli)&lt;br /&gt;
|Celine Dion &amp;amp; Andrea Bocelli&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Top 25 (12 Women)&lt;br /&gt;
|Personal Choice&lt;br /&gt;
|&amp;quot;Love You I Do&amp;quot;&lt;br /&gt;
|Jennifer Hudson&lt;br /&gt;
|11&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Top 13&lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|&amp;quot;I Will Always Love You&amp;quot;&lt;br /&gt;
|Dolly Parton&amp;lt;!-- This section is for artists who sang the song FIRST - not the version which was covered. Dolly sang this first, not Whitney. --&amp;gt;&lt;br /&gt;
|12&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Top 11&lt;br /&gt;
|Year They Were Born&lt;br /&gt;
|&amp;quot;Turn the Beat Around&amp;quot;&lt;br /&gt;
|Vicki Sue Robinson&lt;br /&gt;
|2&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Top 10&lt;br /&gt;
|Billy Joel&lt;br /&gt;
|&amp;quot;Everybody Has a Dream&amp;quot;&lt;br /&gt;
|Billy Joel&lt;br /&gt;
|9&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 9&lt;br /&gt;
|rowspan=2|Their Personal Idols&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Sweet Dreams&amp;quot;&lt;br /&gt;
|Beyoncé&lt;br /&gt;
|7&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;Like a Prayer&amp;quot; / &amp;quot;Borderline&amp;quot; / &amp;quot;Express Yourself&amp;quot; &amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Skylar Laine&lt;br /&gt;
|Madonna&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 8&lt;br /&gt;
|rowspan=2|Songs from the 1980s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;How Will I Know&amp;quot; &lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|7&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Duet&amp;lt;/small&amp;gt; &amp;quot;I Knew You Were Waiting (For Me)&amp;quot; &amp;lt;br/&amp;gt; with Joshua Ledet&lt;br /&gt;
|Aretha Franklin &amp;amp; George Michael&lt;br /&gt;
|10&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 7&lt;br /&gt;
|rowspan=2|Songs from the 2010s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; ''Stuttering&amp;quot;&lt;br /&gt;
|Jazmine Sullivan&lt;br /&gt;
|4&lt;br /&gt;
|rowspan=2|Saved{{ref|1|1}}&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;Stronger (What Doesn't Kill You)&amp;quot;&amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Joshua Ledet&lt;br /&gt;
|Kelly Clarkson&lt;br /&gt;
|9&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 7{{ref|2|2}}&lt;br /&gt;
|rowspan=2|Songs from Now &amp;amp; Then&lt;br /&gt;
|&amp;quot;Fallin'&amp;quot;&lt;br /&gt;
|Alicia Keys&lt;br /&gt;
|5&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;quot;Try a Little Tenderness&amp;quot;&lt;br /&gt;
|Ray Noble Orchestra&amp;lt;!-- This is the original artist; Otis Redding covered it. --&amp;gt;&lt;br /&gt;
|12&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 6&lt;br /&gt;
|Queen&lt;br /&gt;
|&amp;quot;Bohemian Rhapsody&amp;quot;&lt;br /&gt;
|Queen&lt;br /&gt;
|1&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Contestant's Choice&lt;br /&gt;
|&amp;quot;Dance with My Father&amp;quot;&lt;br /&gt;
|Luther Vandross&lt;br /&gt;
|7&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Top 5&lt;br /&gt;
|rowspan=2|Songs from the 1960s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Proud Mary&amp;quot;&lt;br /&gt;
|Creedence Clearwater Revival&amp;lt;!-- Original artists; Ike &amp;amp; Tina Turner COVERED it. --&amp;gt;&lt;br /&gt;
|5&lt;br /&gt;
|rowspan=3|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;(Your Love Keeps Lifting Me) Higher and Higher&amp;quot; &amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Skylar Laine&lt;br /&gt;
|Jackie Wilson&lt;br /&gt;
|9&lt;br /&gt;
|-&lt;br /&gt;
|British pop music|British Pop&lt;br /&gt;
|&amp;quot;You Are So Beautiful&amp;quot;&lt;br /&gt;
|Billy Preston&amp;lt;!-- Check the Wiki page - Preston recorded his version before Joe Cocker did. --&amp;gt;&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=4|Top 4&lt;br /&gt;
|rowspan=3|California Dreamin'&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Steal Away&amp;quot;&lt;br /&gt;
|Jimmy Hughes &amp;lt;!-- Hughes sang this first; Etta covered it. --&amp;gt;&lt;br /&gt;
|4&lt;br /&gt;
|rowspan=4|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Duet&amp;lt;/small&amp;gt; &amp;quot;Eternal Flame&amp;quot;&amp;lt;br&amp;gt;with Hollie Cavanagh&lt;br /&gt;
|The Bangles&lt;br /&gt;
|6&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Quartet&amp;lt;/small&amp;gt; &amp;quot;Waiting for a Girl Like You&amp;quot;&amp;lt;br&amp;gt;with Hollie Cavanagh, Joshua Ledet &amp;amp; Phillip Phillips&lt;br /&gt;
|Foreigner&lt;br /&gt;
|7&lt;br /&gt;
|-&lt;br /&gt;
|Songs They Wish They'd Written&lt;br /&gt;
|&amp;quot;And I Am Telling You I'm Not Going&amp;quot;&lt;br /&gt;
|Jennifer Holliday&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Top 3&lt;br /&gt;
|Judges' Choice&lt;br /&gt;
|&amp;quot;My All&amp;quot;&lt;br /&gt;
|Mariah Carey&lt;br /&gt;
|2&lt;br /&gt;
|rowspan=3|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Contestant's Choice&lt;br /&gt;
|&amp;quot;I Don't Want to Miss a Thing&amp;quot; &lt;br /&gt;
|Aerosmith&lt;br /&gt;
|5&lt;br /&gt;
|-&lt;br /&gt;
|Jimmy Iovine's Choice&lt;br /&gt;
|&amp;quot;I'll Be There&amp;quot;&lt;br /&gt;
|The Jackson 5&lt;br /&gt;
|8&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Finale&lt;br /&gt;
|Simon Fuller's Choice&lt;br /&gt;
|&amp;quot;I Have Nothing&amp;quot;&lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|1&lt;br /&gt;
|rowspan=3|Runner-up&lt;br /&gt;
|-&lt;br /&gt;
|Favorite Performance&lt;br /&gt;
|&amp;quot;The Prayer&amp;quot;&lt;br /&gt;
|Celine Dion &amp;amp; Andrea Bocelli&lt;br /&gt;
|3&lt;br /&gt;
|-&lt;br /&gt;
|Winner's Single&lt;br /&gt;
|&amp;quot;Change Nothing&amp;quot;&lt;br /&gt;
|Jessica Sanchez&lt;br /&gt;
|5&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
==All-Out support from Filipinos==&lt;br /&gt;
[[Thia Megia]], a 16-year old Filipino-American singer and the youngest contestant in the history of AI to enter the Top 13, said that she and her family are supporting Sanchez. She said that she has already worked with Sanchez when she was 13.&lt;br /&gt;
&lt;br /&gt;
Deputy presidential spokesperson Abigail Valte said that [[Malacañang]] joins [[Filipino|Filipinos]] in hoping that Jessica will bag the title of American Idol. She said that they are wishing her the best of luck in the final stretch. Even Vice President [[Jejomar C. Binay]] called on [[Filipino|Filipinos]] around the world to continue supporting Sanchez. [[Jejomar C. Binay|Binay]] said that Sanchez makes the country proud by being vocal of her pride in her [[Filipino]] heritage.&lt;br /&gt;
&lt;br /&gt;
The [[Catholic Bishops' Conference of the Philippines]] (CBCP) urges [[Filipino|Filipinos]] to pray and vote for Sanchez. CBCP's executive sectary said that he is hoping that the youth will be inspired by her perseverance.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*McGrath,Jenny.[http://www.wetpaint.com/american-idol/articles/who-is-jessica-sanchez-american-idol-2012-contestant-background-info “Who is Jessica Sanchez? American Idol 2012 Contestant Background Info”].''Wetpaint American Idol''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.utsandiego.com/uniontrib/20080925/news_lz1sz25studen.html “Student Spotlight: Jessica Sanchez”].''San Diego Union-Tribune.''(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/258096/pinoyabroad/pinoyachievers/malaca-hopes-jessica-sanchez-will-win-american-idol “Malacañang hopes Jessica Sanchez will win 'American Idol'”].''GMA News Online''.(Accessed on May 17, 2012)&lt;br /&gt;
*Chavez, Yong.[http://www.abs-cbnnews.com/entertainment/05/15/12/thia-gives-all-out-support-jessica-idol “Thia gives all-out support for Jessica on 'Idol'].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/global-filipino/05/11/12/vp-binay-rallies-behind-jessica-sanchez “VP Binay rallies behind Jessica Sanchez”].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/249284/showbiz/fil-mexican-jessica-sanchez-makes-it-to-a-i-s-top-24 “Fil-Mexican Jessica Sanchez makes it to A.I.'s top 24”].''GMA News Online''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.spinmoverecords.com/artists/jessica-sanchez/ “Jessica Sanchez”].''move''.(Accessed on May 17, 2012)&lt;br /&gt;
*Sampite, Allison K.[http://www.thestarnews.com/latest-news/tracking-jessica/ “Tracking Jessica”].''The Star News''.(Accessed on May 17, 2012)&lt;br /&gt;
*Anderson-Minshall, Diane.[http://realitytv.about.com/od/americanido1-alpha/tp/Idol-11-Top-5.htm “'American Idol' Finalists”].''About.com: Reality TV''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/entertainment/05/09/12/cbcp-urges-pinoys-pray-vote-jessica-sanchez “CBCP urges Pinoys to pray, vote for Jessica Sanchez”].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*Galarpe, Karen.[http://www.gmanetwork.com/news/story/258596/showbiz/showbizabroad/jessica-sanchez-makes-it-to-top-2-on-american-idol Jessica Sanchez makes it to top 2 on 'American Idol'].''GMA News Online''.(Accessed on May 18, 2012)&lt;br /&gt;
*Mateo, Janvic.[http://thepoc.net/breaking-news/entertainment/15909-jessica-sanchez-makes-it-to-american-idols-top-3.html “Jessica Sanchez makes it to American Idol's Top 3”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
*Mateo, Janvic.[http://thepoc.net/breaking-news/entertainment/15970-jessica-sanchez-to-face-phillips-in-idol-finale.html “Jessica Sanchez to face Phillips in 'Idol' finale”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
*[http://www.rappler.com/entertainment/5783-live-blog-american-idol-finale-performance-night “LIVE BLOG: 'American Idol' finale: Performance night”].''RAPPLER''.(Accessed on May 23, 2012)&lt;br /&gt;
*Ramos, NR.[http://www.mb.com.ph/articles/353646/idol-contender-jessica-sanchez-us-mags-top-pick “'Idol' contender Jessica Sanchez is US mags' top pick”].''mb.com.ph''.(Accessed on May 24, 2012)&lt;br /&gt;
*[http://abcnews.go.com/blogs/entertainment/2012/02/american-idol-judges-praise-unreal-costumed-group-performances-give-standing-ovation/ “‘American Idol’: Judges Praise ‘Unreal’ Costumed Group Performances, Give Standing Ovation”].''abc NEWS''.(Accessed on May 24, 2012)&lt;br /&gt;
*Olivier, Bobby.[http://www.nj.com/entertainment/tv/index.ssf/2012/05/american_idol_2012_winner_phil.html “'American Idol' 2012 winner: Phillip Phillips defeats Jessica Sanchez”].''nj.com''.(Accessed on May 24, 2012)&lt;br /&gt;
&lt;br /&gt;
==External Links==&lt;br /&gt;
*[http://www.myspace.com/jessicaesanchez “Official Jessica Sanchez”]. ''Jessica Sanchez on Myspace''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.youtube.com/jsanchezfan “Official Jessica Sanchez”]. ''Jessica Sanchez on YouTube''.(Accessed on May 17, 2012)&lt;br /&gt;
*[https://twitter.com/#!/JSanchezAI11 “Jessica Sanchez”].''Jessica Sanchez on Twitter''.(Accessed on May 17, 2012)&lt;br /&gt;
*[https://www.facebook.com/JSanchezAI11 “Jessica Sanchez”].''Jessica Sanchez on Facebook''.(Accessed on May 17, 2012)&lt;br /&gt;
*Wenger, Stephanie.[http://www.hollywood.com/news/American_Idol_Jessica_Sanchez_Backstage/23915969 “'American Idol': Inside the Dramatic Save”].''hollywood''.(Accessed on May 17, 2012)&lt;br /&gt;
*Ragaza, Jan Marcel.[http://thepoc.net/thepoc-features/sosyal/sosyal-features/15574-american-idol.html “Can Jessica Sanchez win American Idol?”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
&lt;br /&gt;
&amp;lt;noinclude&amp;gt;&lt;br /&gt;
{{DEFAULTSORT: Sanchez, Jessica}}&lt;br /&gt;
[[Category:Media and Entertainment|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Philippine Singers|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Philippine Women|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Featured Articles for Main Page|Sanchez, Jessica]]&lt;br /&gt;
&amp;lt;/noinclude&amp;gt;&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/fpRroK8_oKM" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 17 May 2012 09:34:29 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Jessica_Sanchez</comments>		</item>
		<item>
			<title>Press freedom in the Philippines</title>
			<link>http://en.wikipilipinas.org/index.php?title=Press_freedom_in_the_Philippines</link>
			<description>&lt;p&gt;Summary: New page: '''Press freedom''' is guaranteed in the [[Constitution of the Philippines]], where it is enshrined in Article III, Section 4.  Although the [[Philippines]] is said to have one of the free...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Press freedom''' is guaranteed in the [[Constitution of the Philippines]], where it is enshrined in Article III, Section 4.&lt;br /&gt;
&lt;br /&gt;
Although the [[Philippines]] is said to have one of the freest press in Asia, Philippine press and news media, from the campus, local, and national levels have suffered censorship, prosecution, intimidation, and attacks, particularly during [[Proclamation No. 1081|Martial Law]]. Currently, the Philippines is ranked 140th in the 2011 Reporters Withour Borders' Press Freedom Index and third in Committee to Protect Journalists' (CPJ) Press Freedom Index.&lt;br /&gt;
&lt;br /&gt;
==Spanish colonial rule==&lt;br /&gt;
Philippine press started with the establishment of the Spanish ''[[Del Superior Govierno]]'', known as the first newspaper published in the Philippines. Like subsequent newspapers published by Spaniards, ''Del Superior Govierno'' catered to the Philippine-based Spanish elite and reported about government affairs and religion.&lt;br /&gt;
&lt;br /&gt;
Nationalist newspapers critical to the Spanish regime were published in Europe, such as ''[[La Solidaridad]]'', or underground, such as the ''[[Kalayaan]]'' and ''La Independenca''. However, these newspapers were not legally and openly allowed to be circulated in the Philippines. Nonetheless, these newspapers contributed to the nationalist ferment and the expansion of the [[Philippine Revolution|Philippine revolution]] against Spanish rule.&lt;br /&gt;
&lt;br /&gt;
==American colonial rule==&lt;br /&gt;
The modern newspaper in the Philippines was pioneered by the American colonial regime. Two currently existing newspapers--''[[The Manila Times]]'' and the ''[[Manila Bulletin]]''--were established during this regime. Though the Americans introduced the concept of democracy and free press to the Philippines, their colonial regime was said to have suppressed nationalist papers such as ''El Nuevo Dia'', ''[[El Renacimiento]]'', and ''Sakdal''.&lt;br /&gt;
&lt;br /&gt;
==Japanese colonial rule==&lt;br /&gt;
The press, as well as radio, was suppressed and attacked during the Japanese occupation as all media were controlled by the Japanese imperial army. However, underground publications by anti-Japanese forces were disseminated.&lt;br /&gt;
&lt;br /&gt;
==Third Republic==&lt;br /&gt;
The years 1946 to 1972 was dubbed as the “Golden Age of Philippine Journalism” for it enjoyed freedom, which was guaranteed by the government. It also spawned a breed of scholarly writers such as [[Armando Malay]], [[Salvador P. Lopez]], [[Arsenio Lacson]], among many others. During that time, the press was viewed as the watchdog of the government, but mainstream media organizations then were owned by big corporations.&lt;br /&gt;
&lt;br /&gt;
==Martial Law==&lt;br /&gt;
Press freedom in the Philippines suffered its biggest blow a day after the proclamation of Martial Law by the late president [[Ferdinand Marcos]]. Marcos' first order on the first day of Martial Law was the immediate closure of all news organizations and on the next day, he ordered the arrest and interrogation of publishers, editors, journalists, and broadcasters identified to be critical against the government.  From 21 to 23 September 1972, publication of newspapers were suspended, and radio and television broadcasts went off air.&lt;br /&gt;
&lt;br /&gt;
On 25 September 1972, the Department of Public Information (DPI) censored all media organizations by virtue of order number one and two, which required all media outlets to seek clearance from the DPI before publishing or airing news and information. Some news organizations resumed operations on said date.&lt;br /&gt;
&lt;br /&gt;
From 1972 to 1981, the Marcos administration issued several decrees ordering the censorship of media and the prohibition of disseminating information that were deemed to undermine the government. Censorship did not only cover local and national media organizations, but international media as well. Campus-based publications, which were known for its radical practice of journalism. were likewise censored or padlocked by the government. During this period, the government formed media censorship organizations such as the Media Advisory Council, Philippine Council for Print Media, and the still existing [[Kapisanan ng mga Brodkaster ng Pilipinas]].&lt;br /&gt;
&lt;br /&gt;
Upon the lifting of Martial Law, Marcos abolished the censorship organizations it established, which started the return of free press. In a short span of time, a number of newspapers published articles critical of the government. These publications were dubbed as the “mosquito press” for they dug deep into the underbellies of the Marcos administration. &lt;br /&gt;
&lt;br /&gt;
The most significant expose after the lifting of Martial Law was the reportedly fake [[Marcos Medals|Marcos World War II medals]], which were published by ''We Forum''. The expose resulted in the government seizure of We Forum. A year later, the ''Philippine Times'' was likewise seized after it ran a story implicating high ranking government and military officials in the assassination of then senator [[Benigno Aquino, Jr.]]&lt;br /&gt;
&lt;br /&gt;
Though it is widely believed that thousands of Filipinos critical against the Marcos regime were summarily executed or assassinated, which may include a significant number of journalists, the [[National Press Club]] officially registered 19 journalists killed and one missing from 1976 to 1985. Meanwhile, the New York-based CPJ registered 12 Filipino journalists killed from 1984 to 1985.&lt;br /&gt;
&lt;br /&gt;
==Post EDSA==&lt;br /&gt;
===Aquino administration===&lt;br /&gt;
After the [[EDSA Revolution of 1986]] which toppled the Marcos regime, press freedom was restored and guaranteed under the 1987 Constitution. As such, Marcos-era laws that were meant to censor the media were repealed. &lt;br /&gt;
&lt;br /&gt;
However, during the administration of [[Corazon Aquino]], AM radio stations [[DZEC]] and DYLA were closed by the government for airing the side of military rebels during a coup attempt in December 1989. In October 1987, at the height of the first wave of coup attempts against the government, Aquino filed a libel case against journalists [[Luis Beltran]] and [[Max Soliven]] due to their report that Aquino allegedly hid under her bed during the coup. Beltran and Soliven were initially convicted but were later acquitted by the [[Philippine Court of Appeals|Court of Appeals]].&lt;br /&gt;
&lt;br /&gt;
===Ramos administration===&lt;br /&gt;
CPJ listed 12 journalists killed under the presidency of [[Fidel Ramos]]. Ten out of the 12 fatalities were killed in different parts of [[Mindanao]] while the other two—[[DZMM]]'s Alberto Berbon and ''[[People's Journal]] Tonight's'' Danny Hernandez—were killed in [[Metro Manila]].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Estrada administration===&lt;br /&gt;
During the [[Joseph Estrada|Estrada]] administration, two newspapers—''The Manila Times'' and the ''[[Philippine Daily Inquirer]]''--ran controversial stories that exposed probable evidences of corruption and plunder in the government. In 9 March 1999, Estrada filed a libel suit against ''The Manila Times'' for its muckraking article on the anomalous P17 billion power contract between an Argentine firm and the [[National Power Corporation]] which led to the issuance of a public apology by the newspaper's publishers. Consequently, Estrada withdrew the libel suit but some members of the editorial board of  ''The Manila Times'' resigned and eventually, ''The Manila Times'' closed on 22 July 1999 but was re-opened five months later under the ownership of know Estrada ally [[Mark Jimenez]]. The newspaper was later sold to its current owner Dante Ang.&lt;br /&gt;
&lt;br /&gt;
Meanwhile, on 10 July 1999 the ''Philippine Daily Inquirer'' suffered a political blow when movie advertisers withdrew their advertisements from the broadsheet two days after Estrada met with them. Former [[Office of the Press Secretary|Press Secretary]] [[Rodolfo Reyes]] said that the ''Inquirer's'' “biased reporting” led to the withdrawal of movie ads.&lt;br /&gt;
&lt;br /&gt;
In January 2001, Estrada was ousted via the second EDSA uprising, which installed then vice-president [[Gloria Macapagal-Arroyo]]. The so-called [[EDSA Revolution of 2001|EDSA Dos]] received a blow-by-blow coverage by the national and foreign press, and it is said that the non-violent uprising was a result of several investigative articles that exposed alleged anomalies under the Estrada administration.&lt;br /&gt;
&lt;br /&gt;
CPJ tallied three radiomen killed under the Estrada administration. &lt;br /&gt;
&lt;br /&gt;
===Arroyo administration===&lt;br /&gt;
Under the Arroyo administration, cases of media killings and attacks suddenly increased in numbers, making the Philippines one of the most dangerous countries in the world for journalists under her term. During her nine-year regime, 85 journalists and two media workers were killed, which is considered as having the most media fatalities after Martial Law. &lt;br /&gt;
&lt;br /&gt;
Furthermore, a daily broadsheet--''[[The Daily Tribune]]''--was raided by the government a day after Arroyo proclaimed a [[2006 State of Emergency in the Philippines|State of National Emergency]] on 24 February 2006, at the height of anti-Arroyo rallies and the [[Philippine Marine Corps|Marine]] standoff in [[Camp Aguinaldo]]. Arroyo likewise said that the government was “monitoring” the press and that “subversive” commentaries and reports will be prohibited during that State of National Emergency. &lt;br /&gt;
&lt;br /&gt;
Also in 2006, First Gentleman [[Mike Arroyo]] filed ten libel suits against 45 journalists, which were later dismissed. Inquirer publisher Isagani Yambot and seven of his editors notably posted bail after being held at the Manila Police District Station 10 in [[Pandacan, Manila]]. &lt;br /&gt;
&lt;br /&gt;
On 29 November 2009, journalists and media workers covering the so-called [[Manila peninsula rebellion|Manila Peninsula Siege]], when military forces under the leadership of rebel soldier-turned-senator [[Antonio Trillanes IV]] took over the [[Manila Peninsula Hotel]] in protest of the Arroyo administration, were detained at Camp Bagong Diwa in [[Taguig]]. On 15 November 2011, the [[Supreme Court]] revived the class suit filed by the detained journalists against the arresting police officers during the stand-off.&lt;br /&gt;
&lt;br /&gt;
On 23 November 2009, 58 people, including 32 journalists and two media workers, were summarily executed in [[Ampatuan, Maguindanao]]. Dubbed as the [[Maguindanao Massacre]], which was allegedly perpetuated by prominent members of the [[Ampatuan Clan|Ampatuan political clan]] in [[Maguindanao]] to prevent the nomination of political rival and incumbent Maguindanao governor [[Esmael Mangudadatu]], is considered as the single deadliest attack against journalists in history.&lt;br /&gt;
&lt;br /&gt;
===Benigno Simeon Aquino III administration===&lt;br /&gt;
CPJ listed eight journalists killed under the current administration of [[Benigno Simeon Aquino III]]. The most prominent case of media killing is on DWAR anchor and anti-mining activist [[Gerry Ortega]], who was allegedly killed under the orders of former [[Palawan]] governor [[Joel T. Reyes]]. Reyes is currently in hiding and is facing murder raps in Palawan. &lt;br /&gt;
&lt;br /&gt;
Aquino meanwhile scored the media for its “inaccurate” and “unfair” reporting. On the 16th founding anniversary of the [[Philippine Press Institute]], Aquino admonished the [[Malacanang]] Press Corps to follow the principle of “getting it first, and getting it right” since inaccurate stories will affect the image of the country. &lt;br /&gt;
&lt;br /&gt;
 &lt;br /&gt;
==Campus press freedom in the Philippines==&lt;br /&gt;
In 1991, the Campus Journalism Act of 1991 (CJA) was enacted, which specified the rights and responsibilities of student journalists and publications. However, the law did not provide a penalty clause against offenders. Despite its existence, the [[Pamantasan ng Lungsod ng Maynila]] (PLM) administration under then president [[Benjamin Tayabas]] shut down PLM's student publication ''[[Ang Pamantasan]]'' in 1992 and 2004 and dismissed some of its editors and staff after the publication ran stories on probable evidence of corruption and malversation of funds under the Tayabas administration. A number of cases of student publications which were shut down were also reported after the enactment of CJA while censorship bodies still exist in a number of private schools in the Philippines.&lt;br /&gt;
&lt;br /&gt;
As of 2005, a significant number of campus publications in the Philippines were threatened to be closed. Wrote Lloyd A. Luna of the Network of Campus Journalists of the Philippines:&lt;br /&gt;
&lt;br /&gt;
''”· By the end of 2005, another 20-30% of the total existing publication today will be closed&lt;br /&gt;
· In all parts of the country, non-mandatory collection of publication fee may be implemented in more than 100 schools.&lt;br /&gt;
· In the [[National Capital Region]], 35-45% may still exist through advertisement revenues&lt;br /&gt;
· In Northern Luzon, roughly 10-20% may not be supported by the school administration; in the [[Visayas]], 15-25%; and in [[Mindanao]],, 20-30%”''&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Freedom of Information and Right of Reply==&lt;br /&gt;
Aside from physical attacks and intimidation against journalists, the lack of a Freedom of Information law is seen by a number of media organizations and civil society groups as a hindrance in reporting the state of government funds, which is historically tainted with cases of corruption and plunder. &lt;br /&gt;
&lt;br /&gt;
On 4 June 2011, the [[14th Congress of the Philippines|14th Congress]] junked with finality the FOI Act, as then [[Speaker of the Philippine House of Representatives||House Speaker]] [[Prospero Nograles]] declared a lack of quorum in passing the law.&lt;br /&gt;
&lt;br /&gt;
The FOI Act, though endorsed by President Aquino as a priority bill, is still pending in the 15th Congress. However, versions of the FOI Act filed by representatives [[Rodolfo Antonino]] (4th District, [[Nueva Ecija]]) and [[Pedro Romualdo]] ([[Camiguin]]) contains the “Right of Reply” (ROR) clause, which mandates media organizations to provide an equal space for the reply of government officials on issues addressed on them. However, the [[Freedom Fund for Filipino Journalists]] (FFFJ) and the [[National Union of Journalists of the Philippines]] rejected the ROR clause in Antonino's and Romualdo's version of the FOI as it is deemed as a “contraint” to editorial freedom.&lt;br /&gt;
&lt;br /&gt;
FFFJ stated: ''“The right of reply is in the first place already part of the professional and ethical responsibilities of the press, whether in print, online or broadcast. It is inherent in the ethical imperative of fairness, which mandates the presentation of all sides in a controversy. The principal function of the Philippine Press Institute’s Press Council is in fact to guarantee the right of reply. If that right has not always been respected in practice by some journalists, it is not a justification for subjecting all media organizations to a constraint on their freedom simply because of the failings of a few. Enshrining in law the punishment of all for the errors of a few is not only unreasonable. It is also dangerous, since it would infringe on a freedom vital to the health of a democracy.”''&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.cmfr-phil.org/2007/09/01/back-to-the-past-a-timeline-of-press-freedom/ Back to the Past: A timeline of press freedom]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*Tuazon, Ramon R. [http://www.ncca.gov.ph/about-culture-and-arts/articles-on-c-n-a/article.php?igm=3&amp;amp;i=221 The Print Media: A Tradition of Freedom]. National Commission for Culture and the Arts. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.cmfr-phil.org/2012/01/27/philippines-ranked-140th-in-press-freedom-index/ Philippines ranked 140th in Press Freedom Index]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*Escote, Alixander Haban. [http://socyberty.com/history/a-history-of-broadcasting-in-the-philippines-from-world-war-ii-to-the-birth-of-philippine-television/ A History of Broadcasting in the Philippines From World War II to the Birth of Philippine Television]. Socyberty.com. (Accessed on 24 April 2012)&lt;br /&gt;
*Hisona, Harold. [http://www.phnewsnetwork.com/2011/06/headlines/557-maguindanao-massacre-ranks-philippines-3rd-in-media-killing.html Maguindanao Massacre Ranks Philippines 3rd in Media Killing]. Philippine News Network. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://opinion.inquirer.net/25031/media-killings-watch Editorial: Media killings watch]. Philippine Daily Inquirer. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://pcij.org/blog/2006/06/02/govt-inaction-on-media-killings-encourages-attacks Media killings: Gov't inaction 'encourages attacks']. The Philippine Center for Investigative Journalism Blog. (Accessed on 24 April 2012)&lt;br /&gt;
*Baldemor, Mindy. [http://www.thepoc.net/thepoc-features/politi-ko/politiko-opinions/14174-make-impunity-history.html Make Impunity History]. The Philippine Online Chronicles. (Accessed on 24 April 2012)&lt;br /&gt;
*Tan, Fidelis. [http://www.thepoc.net/breaking-news/breaking-stories/15715-ph-third-in-the-world-in-unsolved-journalist-killings.html PH third in the world in unsolved journalist killings]. The Philippine Online Chronicles. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://cpj.org/killed/asia/philippines/ 72 Journalists Killed in the Philippines since 1992]. Committee to Protect Journalists. (Accessed on 24 April 2010)&lt;br /&gt;
*Maguddayao, Merck. [http://pcij.org/blog/2010/06/04/nograles-buries-foi-act-for-lack-of-quorum Nograles buries FOI Act for 'lack of quorum']. The Philippine Center for Investigative Journalism Blog. (Accessed on 24 April 2012)&lt;br /&gt;
*Luna, Lloyd A. [http://lloydluna.tigblog.org/post/27113 Campus Journalism in the Philippines: Mind the Gap]. Network of Campus Journalists of the Philippines. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.manilatimes.net/index.php/news/top-stories/12196-sc-revives-medias-peninsula-siege-suit SC revives media's Peninsula siege suit]. The Manila Times. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.cmfr-phil.org/2012/04/19/attacking-press-freedom-while-enhancing-it/ Attacking press freedom while &amp;quot;enhancing&amp;quot; it]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://pcij.org/blog/2012/04/23/practice-balance-and-fairness-pnoy-tells-philippine-media Practise balance and fairness, Pnoy tells Philippine media]. The Philippie Center for Investigative Journalism. (Accessed on 24 April 2012)&lt;br /&gt;
*Avendano, Christine O. [http://newsinfo.inquirer.net/181435/aquino-slams-media-for-inaccurate-negative-reporting Aquino slams media for inaccurate, negative reporting]. Philippine Daily Inquirer. (Accessed on 24 April 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
&lt;br /&gt;
[[Category:Philippine History]]&lt;br /&gt;
[[Category:Philippine Mass Media]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/_-TUonOJEsw" height="1" width="1"/&gt;</description>
			<pubDate>Tue, 24 Apr 2012 12:12:37 GMT</pubDate>			<dc:creator>Wikimercky</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Press_freedom_in_the_Philippines</comments>		</item>
		<item>
			<title>Glicerio Sua</title>
			<link>http://en.wikipilipinas.org/index.php?title=Glicerio_Sua</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Glicerio Sua''' was the former Commanding General of the [[1st Infantry Division]] of the [[Philippine Army]]. He was the first member of his class to be promoted ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Glicerio Sua''' was the former Commanding General of the [[1st Infantry Division]] of the [[Philippine Army]]. He was the first member of his class to be promoted to Brigadier General. He was the Commander of the Task Force Comet, when the group launched a mission to rescue Martin and Gracia Burnham and [[Deborah Yap]]. Sua is a member of the PMA Class of 1972. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
Sua obtained his Bachelors degree from the [[Philippine Military Academy]] and is a member of the PMA Class of 1972. He is the most senior member of his class and the first to be promoted to Brigadier General. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Sua is a member of the Army’s elite [[Scout Rangers]]. One of his major field accomplishments was the successful rescue of several schoolchildren kidnapped in [[Basilan]] in 2000. The schoolchildren were all rescued safely, though some of their teachers were already dead, tortured and executed by the [[Abu Sayyaf Group]].&lt;br /&gt;
&lt;br /&gt;
He served as the Deputy Commander of the 1ID (Tabak Division), before being appointed as its Commanding General after General [[Romeo Dominguez]] was removed in his alleged involvement at the incident in Lamaitan. He led the Task Force Comet working to free missionaries Martin and Gracia Burnham. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.pinoyexchange.com/forums/showthread.php?t=75853&amp;amp;page=3 Pinoy Exchange]&lt;br /&gt;
*[http://www.thefreelibrary.com/Letters+suggesting+$2+mil.+ransom+for+U.S.+hostages+'genuine'.-a084260323 Letters suggesting $2 mil. ransom for U.S. hostages 'genuine']&lt;br /&gt;
*[http://www.angelfire.com/journal2/nbondoc/hostage_crisis_in_basilan.htm The Hostage Crisis in Basilan]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1972]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/a9dm_qNUyQ4" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 15 Mar 2012 15:19:24 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Glicerio_Sua</comments>		</item>
		<item>
			<title>Alfonso Dagudag</title>
			<link>http://en.wikipilipinas.org/index.php?title=Alfonso_Dagudag</link>
			<description>&lt;p&gt;Summary: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Lieutenant General Alfonso Dagudag''' was the former Commanding General of the [[South Luzon Command]] (Solcom) of the [[Philippine Army]]. He also commanded the [[4th Infantry Division]] and [[8th Infantry Division]]. Upon retiring from military service, Dagudag was appointed by former President [[Gloria Macapagal Arroyo]] [[Department of Environment and Natural Resources]] Anti-Illegal Logging Task Force. Dagudag is a graduate of Siliman University. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Dagudag obtained his Bachelors degree from the Siliman University.&lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
While in active service, Dagudag once commanded the 14th Infantry Battalion of the 8th Infantry Division. From August 28, 1987 to March 1, 1990, he served as the Commanding General of the 8ID. He also served as the CG of the 4th Infantry Division. He also served as the Army’s Vice Commander. &lt;br /&gt;
&lt;br /&gt;
Before his retirement, he was appointed as the Commander of the [[South Luzon Command]] of the Philippine Army. He was promoted to Major General on February 2002 &lt;br /&gt;
&lt;br /&gt;
Dagudag also served as a Board Member for the AFP Housing Board. &lt;br /&gt;
==Post-military appointment==&lt;br /&gt;
On December 2004, former President Arroyo announced the formation of the DENR Anti-Illegal Logging Task Force and the appointment of retired Lieutenant General Alfonso Dagudag as head of the task force. The Task Force was named as Task Force Sagip Kalikasan. &lt;br /&gt;
&lt;br /&gt;
He was appointed because Dagudag is familiar with the Sierra Madre mountain range and other forest systems in the area and once belonged to the military's elite [[Scout Ranger]] Regiment.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=200817 New Southcom chief named]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-1999/2000-05-24-afp-housing.html AFP Housing Program]&lt;br /&gt;
*[http://www.mb.com.ph/node/120560 Pampanga folk try to stop seizure of ‘hot narra lumber]&lt;br /&gt;
*[http://www.afrim.org.ph/Archives/2004/Phil%20Daily%20Inquirer/December/02/Forest%20rangers%20to%20be%20armed.txt Anti-illegal logging unit formed]&lt;br /&gt;
*[http://www.newsflash.org/2002/09/hl/hl016708.htm 20 Abus killed in offensive]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: South Luzon Command Commanders]]&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/-6oAugKHP-c" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 15:55:20 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Alfonso_Dagudag</comments>		</item>
		<item>
			<title>Nemesio Sigaya</title>
			<link>http://en.wikipilipinas.org/index.php?title=Nemesio_Sigaya</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Nemesio Sigaya''' was the former Commander of the Air Defense Command of the [[Philippine Air Force]]. He was promoted to Major General on February 2002. Sigaya is...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Nemesio Sigaya''' was the former Commander of the Air Defense Command of the [[Philippine Air Force]]. He was promoted to Major General on February 2002. Sigaya is a graduate of the Philippine Air Force Flying School in 1970. Sigaya is also an amateur painter.  He was one of the 100 Outstanding Alumni awardees of the [[West Visayas State University]]. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Sigaya is a graduate of the Aviation Cadet Program Class 1970 from the Philippine Air Force Flying School. . He took up his Masters in National Security Administration at the [[National Defense College of the Philippines]].&lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Sigaya has the distinction of being one of the six Filipino pilots who were trained to fly the F-8H Crusader in Dallas, Texas, USA. He served as the Commander of the 530th CTW during the campaign against the [[Moro Islamic Liberation Front]] and [[Abu Sayyaf Group]]. His last designation was serving as the Commander of the Air Defense Command. &lt;br /&gt;
&lt;br /&gt;
Sigaya has flew T-33, F-86F Sabrejackets, and F-8H Crusaders. He was promoted to Major General on February 2002. &lt;br /&gt;
&lt;br /&gt;
==Fund raising contribution==&lt;br /&gt;
Sigaya is also an amateur painter. He held an exhibit of his water color paintings at the Philippine Air Force Museum, [[Villamor Air Base]] on January 2012. His paintings depict the participation as fighter pilots in the pacification campaign against the secessionist rebels in the 70’s. &lt;br /&gt;
&lt;br /&gt;
The funds that will be collected will be for the benefit of Basa Air Base Hospital, Fighter town, Basa Air Base, Florida blanca, [[Pampanga]].&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.medskul.com/forum/archive/index.php/t-1702.html WVSU honors 100 Outstanding Alumni of the Century]&lt;br /&gt;
*[http://pafcirca70s.blogspot.com/2012/01/appeal-and-invitation.html A fund raising campaign of Maj. Gen. Sigaya]&lt;br /&gt;
*[http://pafcirca70s.blogspot.com/view/classic?z A fund raising campaign of Maj. Gen. Sigaya]&lt;br /&gt;
*[http://webcache.googleusercontent.com/search?q=cache:iPUIxBYpubYJ:www.scribd.com/doc/2086640/25/The-Way-Ahead+&amp;amp;cd=5&amp;amp;hl=tl&amp;amp;ct=clnk&amp;amp;gl=ph The Way Ahead]&lt;br /&gt;
*[http://beatingtheodds.ph/govph/index2.php?option=com_content&amp;amp;do_pdf=1&amp;amp;id=15851 GMA Swears in new envoys, promoted generals]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Philippine Air Force Generals]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: Filipino painters]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/LRtDEvs3Qnk" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 12:54:10 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Nemesio_Sigaya</comments>		</item>
		<item>
			<title>Ruben Domingo</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ruben_Domingo</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Vice Admiral Ruben Domingo''' was the former Commander of the [[Armed Forces of the Philippines]] [[Western Command]] based in [[Puerto Prinsesa]]. Domingo also served as the Co...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Vice Admiral Ruben Domingo''' was the former Commander of the [[Armed Forces of the Philippines]] [[Western Command]] based in [[Puerto Prinsesa]]. Domingo also served as the Commander of the Philippine Fleet. He was promoted to Vice Admiral on 2002, and retired on February 14, 2006 upon reaching the mandatory retirement age of 56. He is a member of the [[Philippine Military Academy]] Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Domingo obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Domingo served the [[Philippine Navy]] for a total of 35 from the time he graduated from the PMA in 1971 until his retirement in 2006. His last assignments were serving as the Commander of the Western Command of the AFP; and Commander of the [[Philippine Fleet]]. Domingo received his third star and was promoted to Vice Admiral on February 2002. &lt;br /&gt;
&lt;br /&gt;
==Notable contributions==&lt;br /&gt;
&lt;br /&gt;
On December 1999, Domingo was appointed as the Commander of the Naval Education and Training Command. Because of the NETC’s notoriety of corruption, he immediately set into motion a reform program centered into the cleansing of the procurement system. This resulted in P5 million worth of savings, which were then used to improve other training facilities and equipment. All his purchases went through canvassing and bidding procedures of procurement set forth by existing laws and guidelines.&lt;br /&gt;
&lt;br /&gt;
Dominguez involved the Intelligence division to monitor the process and set up entrapment operations whenever necessary.&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
For his contributions to the Navy, Dominguez was awarded [[Distinguished Service Star]].&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.newsflash.org/2002/02/hl/hl015297.htm New Ambassadors sworn, generals promoted]&lt;br /&gt;
*[http://www.mb.com.ph/node/57802 5 top AFP officers named to key posts by Chief of Staff]&lt;br /&gt;
*[http://www.newsflash.org/2004/02/hl/hl103442.htm Palace warns coddlers of Faeldon]&lt;br /&gt;
*[http://pcij.org/HotSeat/trillanes3.html A study of corruption in the Philippine Navy]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: Philippine Navy Commanders]]&lt;br /&gt;
[[Category: Vice Admirals]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/959g96iSWW4" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 11:42:49 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ruben_Domingo</comments>		</item>
		<item>
			<title>Clyde Fernandez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Clyde_Fernandez</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Deputy Director General Clyde Fernandez''' was the former [[Philippine National Police]] Deputy Director for Administration. He served as the Executive Director for Center for T...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Deputy Director General Clyde Fernandez''' was the former [[Philippine National Police]] Deputy Director for Administration. He served as the Executive Director for Center for Translational Crimes. Fernandez retired on April 1, 2003 and is a member of the [[Philippine Military Academy]] Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Fernandez obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Fernandez last assignments while in active service included serving as the Deputy Director for Administration and Executive Director of Center for Transnational Crimes. Upon retiring from service, Fernandez was the second-in-command of the PNP. At one point in his career, he also served as the Director for Intelligence. &lt;br /&gt;
&lt;br /&gt;
His last promotion to Deputy Director Generals, equivalent to a three-star rank in the armed forces, sparked some outrage since he was promoted a Director less than six months ago. Fernandez officially retired on April 1, 2003. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=157520 Mendoza defends promotions]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=154070&amp;amp;publicationSubCategoryId=63 PNP junior officers lambast general’s ‘early’ promotion]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=168421 7 sacked cops to get key posts, after all]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: PMA Class of 1970]]&lt;br /&gt;
[[Category: Philippine National Police personnel]]&lt;br /&gt;
[[Category: Deputy Director Generals]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/D570EL7gAVk" height="1" width="1"/&gt;</description>
			<pubDate>Tue, 13 Mar 2012 03:00:36 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Clyde_Fernandez</comments>		</item>
		<item>
			<title>Romeo Dominguez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Romeo_Dominguez</link>
			<description>&lt;p&gt;Summary: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Lieutenant General Romeo Dominguez''' was the former Commanding General of the [[North Luzon Command]] of the [[Philippine Army]]. He also served as the Commanding General of the 8th Infantry Division and [[Task Force Comet]]. In 2001, Dominguez was accused by Fr. [[Cirilo Nacorda]] of conniving with the [[Abu Sayyaf]] members and distributing the ransom money. Dominguez has denied all allegations. He is a member of the [[Philippine Military Academy]] Class of 1971.&lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Dominguez is a member of the PMA Class of 1971. His classmates include Senators [[Panfilo Lacson]] and [[Gringo Honasan]]. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Dominguez served as the Commanding General of the [[1st Infantry Division]] and [[8th Infantry Division]] of the Philippine Army. He was then appointed to Command the North Luzon Command (Nolcom), where he subsequently earned his third start and was promoted to Lieutenant General. &lt;br /&gt;
&lt;br /&gt;
===Allegations on Abu Sayyaf connivance===&lt;br /&gt;
&lt;br /&gt;
In 2001, Lamaitan parish priest Fr. Cirilo Nacorda accused Dominguez of conniving with the Abu Sayyaf Group  (ASG) on the ransom money. He was also investigated on the escape of the ASG after they were supposedly corned in the Lamaitan hospital. Further controversy hounded Dominguez when former ASG hostage and American preacher Gracia Burnham, in her book In the Presence of My Enemies, detailed how an unnamed military general even demanded a 50 percent cut from the ransom being demanded by the bandits.&lt;br /&gt;
&lt;br /&gt;
On August 2003, Armed Forces Chief of Staff [[Narciso Abaya]], cleared Dominguez of any collusion with the ASG. Dominguez’s promotion to Major General was put on hold by the [[Commission on Appointments]] initially, but eventually confirmed his rank as Major General. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2002/03-14-press-statement-maj-gen-dominguez.html Press statement of Maj. Gen. Dominguez]&lt;br /&gt;
*[http://www.bulatlat.com/archive1/028basilan.html House Hearing on AFP-Abu connivance elicits more questions than answers]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=132108  Gen. Dominguez, pinaiyak ng mga senador]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: North Luzon Command Commanders]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/vuhE3L1uTN0" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 12 Mar 2012 16:31:28 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Romeo_Dominguez</comments>		</item>
		<item>
			<title>ISRAEL, EDGARDO</title>
			<link>http://en.wikipilipinas.org/index.php?title=ISRAEL%2C_EDGARDO</link>
			<description>&lt;p&gt;Summary: [[ISRAEL, EDGARDO]] moved to [[Edgardo Israel]] over redirect&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Rear Admiral Edgardo Israel''' was the former Commander of the Civil Relations Service of the [[Armed Forces of the Philippines]] and previously the AFP Inspector General. He is a member of the [[Philippine Military Academy]] Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Israel obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
As a Commodore in the Philippine Navy, Israel was appointed as AFP Inspector General. He was then promoted to Major General on May 2003. &lt;br /&gt;
&lt;br /&gt;
On June 10, 2003, he was appointed as the Head of the Civil Relations Service of the AFP. During his term, the Command spearheaded advocacy campaign for the AFP and the duly - constituted government in order to neutralize the propaganda efforts of the misguided soldiers during the failed mutiny on July 27, 2003 popularly known as [[Oakwood Mutiny]].&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
&lt;br /&gt;
Israel is a recipient of the [[Distinguished Serviced Stars]]. He also received numerous medals and ribbons among them the Bintang Yudha Dharma Nararya from the President of Indonesia.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.myheritage.com/site-30251261/alisangco?popup=4%2C+9343645390#notificationPanelAnchor OFWs: Are they really our heroes?]&lt;br /&gt;
*[http://findarticles.com/p/news-articles/manila-bulletin/mi_7968/is_2003_August_3/corpus-named-afp-civil-relations/ai_n33524900/ Corpus named chief of AFP civil relations service]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2002/09-10-cabuay-assumes-new-military-post.html Cabuay assumes new military post]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1970]]&lt;br /&gt;
[[Category: Rear Admirals]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/MwepzGkk2fU" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 12 Mar 2012 01:32:07 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ISRAEL%2C_EDGARDO</comments>		</item>
		<item>
			<title>Ralph Flores</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ralph_Flores</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Ralph Flores''' was the former Commander of the Air Logistics and Support Command of the [[Philippine Air Force]]. In 2005, Flores was demoted to Colonel, and his ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Ralph Flores''' was the former Commander of the Air Logistics and Support Command of the [[Philippine Air Force]]. In 2005, Flores was demoted to Colonel, and his promotions to Brigadier General and Major General were revoked for null and void by reason of his ineligibility for said appointments on account of his age. In 2011, the Sandiganbayan division acquitted Flores and cleared him of all falsification charges due to insufficiency of evidence. Flores is a member of the [[Philippine Military Academy]] Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Flores obtained his Bachelors degree form the Philippine Military Academy and is a member of the PMA Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Flores last designation in active duty was serving as Commander of the Philippine Air Force Air Logistics and support command. He was promoted to Brigadier General on July 18, 2002; and to Major General on April 15, 2003. &lt;br /&gt;
&lt;br /&gt;
===Demotion to the rank of Colonel===&lt;br /&gt;
&lt;br /&gt;
On April 2005, his promotion to the ranks of Brigadier General and Major General were revoked	 and deemed null and void by reason of his ineligibility for said appointments on the account of his age. &lt;br /&gt;
&lt;br /&gt;
Flores allegedly falsified his birth certificate and declared that he was born on March 30, 1949, and not on 1946 as what his original birth date is. As such, Flores should have had retired on March 30, 2002 upon reaching the mandatory retirement age of 56.&lt;br /&gt;
&lt;br /&gt;
A fact-finding committee was created on order from former CSAFP Gen. [[Narciso L Abaya]] to investigate the said allegation. The committee was headed by Major General [[Raul Relano]] and the committee established the fact that indeed Flores was born in 1946 based on PMA cadet information sheet and baptismal certificate.&lt;br /&gt;
&lt;br /&gt;
He was ordered to return all compensation, allowances and benefits he received after his mandatory retirement; and all awards he received from that period were also withdrawn. &lt;br /&gt;
&lt;br /&gt;
===Acquittal===&lt;br /&gt;
&lt;br /&gt;
On April 2011, the Sandiganbayan, voting, 3-2, acquitted Flores of falsification charges due to insufficiency of evidence. The Sandiganbayan reasoned that five of the charges were invalid because the documents they were based on did not qualify as public documents as defined by law, which were: Flores’ personal and family background, summary of information, medical history, medical examination and dental health record.&lt;br /&gt;
&lt;br /&gt;
Of the four remaining charges, the court agreed that the annual income tax returns of the accused for 1999, 2000 and 2001 as well as his NBI clearance for 2003 were all public documents where he declared his birth year as 1949.&lt;br /&gt;
&lt;br /&gt;
The court thus, cleared Flores of any criminal liability noting that the disclosure of one’s date of birth or an erroneous statement about it does not affect the purpose for which said documents were issued.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2003/05-18-arroyo-okays-promotion-of-74-senior-afp-officers.html Arroyo okays promotion of 74 senior AFP officers]&lt;br /&gt;
*[http://www.malaya.com.ph/apr15/news16.html Ex-PAF general acquitted on falsification raps]&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/217804/news/nation/court-clears-ex-paf-general-of-falsification-charges Court clears ex-PAF general of falsification charges]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=273993 For falsifying age, AFP general demoted]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/tOo8z-7DCpk" height="1" width="1"/&gt;</description>
			<pubDate>Sun, 11 Mar 2012 13:52:48 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ralph_Flores</comments>		</item>
	</channel>
</rss>

